Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7NFGXF)

DOT Name	Choriogonadotropin subunit beta variant 1 (CGB1)
Gene Name	CGB1
Related Disease	Hydatidiform mole ( ) Ovarian cancer ( ) Advanced cancer ( ) Epithelial ovarian cancer ( ) Ovarian neoplasm ( )
UniProt ID	CGB1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00007
Sequence	MSTFPVLAEDIPLRERHVKGRVDPHFRAPKMEMFQRLLLLLLLSMGGTWASKEPLRPRCR PINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLP GCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPS PSRLPGP
Tissue Specificity	Expressed in placenta, testis and pituitary.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Hydatidiform mole	DISKNP7O	Strong	Altered Expression	[1]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[2]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[3]
Epithelial ovarian cancer	DIS56MH2	Limited	Biomarker	[4]
Ovarian neoplasm	DISEAFTY	Limited	Biomarker	[4]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Choriogonadotropin subunit beta variant 1 (CGB1).	[5]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Choriogonadotropin subunit beta variant 1 (CGB1).	[8]
------------------------------------------------------------------------------------

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Choriogonadotropin subunit beta variant 1 (CGB1).	[6]
Pioglitazone	DMKJ485	Approved	Pioglitazone increases the expression of Choriogonadotropin subunit beta variant 1 (CGB1).	[7]
Forskolin	DM6ITNG	Investigative	Forskolin increases the expression of Choriogonadotropin subunit beta variant 1 (CGB1).	[9]
------------------------------------------------------------------------------------

References

1	Fine-scale quantification of HCG beta gene transcription in human trophoblastic and non-malignant non-trophoblastic tissues.Mol Hum Reprod. 2008 Jan;14(1):23-31. doi: 10.1093/molehr/gam082. Epub 2007 Nov 29.
2	Regulation of human chorionic gonadotropin beta subunit expression in ovarian cancer.BMC Cancer. 2019 Jul 30;19(1):746. doi: 10.1186/s12885-019-5960-2.
3	Novel insights into the expression of CGB1 & 2 genes by epithelial cancer cell lines secreting ectopic free hCG.Anticancer Res. 2014 May;34(5):2239-48.
4	Human chorionic gonadotropin beta subunit genes CGB1 and CGB2 are transcriptionally active in ovarian cancer.Int J Mol Sci. 2013 Jun 17;14(6):12650-60. doi: 10.3390/ijms140612650.
5	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
6	Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
7	Peroxisome proliferator activated receptor gamma (PPAR-gama) ligand pioglitazone regulated gene networks in term human primary trophoblast cells. Reprod Toxicol. 2018 Oct;81:99-107.
8	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
9	Effects of valproic acid on syncytialization in human placental trophoblast cell lines. Toxicol Appl Pharmacol. 2023 Sep 1;474:116611. doi: 10.1016/j.taap.2023.116611. Epub 2023 Jun 28.