Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7PL1Q6)

• DOT Name: Cilia- and flagella-associated protein 119 (CFAP119)
• Synonyms: Coiled-coil domain-containing protein 189
• Gene Name: CFAP119
• UniProt ID: CF119_HUMAN
• Pfam ID: PF14769
• Sequence:
  MLNRKTSHFLGMRVQSELEHLSELRREAGKDRSSVHGSAARTRASVRTQWTTAAAAKADE
  DPGANLFPPPLPRPRICMWKYLDVHSMHQLEKTTNAEMREVLAELLELGCPEQSLRDAIT
  LDLFCHALIFCRQQGFSLEQTSAACALLQDLHKACIATPLGNVEECYRYFTSVLFCHGVR
  RPPFSIDLFKEEQLLALEDYVVNTYFRHFKLYKYVFTPQVRLDLSLTYMGLQPPKLWPES
  ETEKEESKEMEEQAVTPQKEELETVAPPEPEPSHIHVLRAYIKTQVNKELEQLQGLVEER
  LKASEERLSSKLTALERPFQLPPGKGKSKTK

Molecular Interaction Atlas (MIA) of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Cilia- and flagella-associated protein 119 (CFAP119).	[1]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Cilia- and flagella-associated protein 119 (CFAP119).	[2]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Cilia- and flagella-associated protein 119 (CFAP119).	[3]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of Cilia- and flagella-associated protein 119 (CFAP119).	[4]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Cilia- and flagella-associated protein 119 (CFAP119).	[5]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [3] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [4] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [5] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.