Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT80VTZO)

• DOT Name: Cancer/testis antigen family 45 member A1 (CT45A1)
• Synonyms: Cancer/testis antigen 45-1; Cancer/testis antigen 45A1
• Gene Name: CT45A1
• Related Disease:
  Adenocarcinoma
  Advanced cancer
  Breast cancer
  Breast carcinoma
  Epithelial ovarian cancer
  Lung cancer
  Lung carcinoma
  Neoplasm
  Ovarian cancer
  Ovarian neoplasm
  Seminoma
  Testicular cancer
• UniProt ID: CT451_HUMAN
• Pfam ID: PF15300
• Sequence:
  MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKAKKLMT
  GHAIPPSQLDSQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQR
  EINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKH
  LKKKLKRMI
• Tissue Specificity: Testis specific. Expressed in cancer cell lines.

Molecular Interaction Atlas (MIA) of This DOT

12 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[1]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[1]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[3]
Lung cancer	DISCM4YA	Strong	Altered Expression	[1]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[1]
Neoplasm	DISZKGEW	Strong	Biomarker	[4]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[3]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[3]
Seminoma	DIS3J8LJ	Strong	Altered Expression	[5]
Testicular cancer	DIS6HNYO	moderate	Biomarker	[6]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Cancer/testis antigen family 45 member A1 (CT45A1).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Cancer/testis antigen family 45 member A1 (CT45A1).	[10]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Cancer/testis antigen family 45 member A1 (CT45A1).	[8]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate affects the expression of Cancer/testis antigen family 45 member A1 (CT45A1).	[9]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Cancer/testis antigen family 45 member A1 (CT45A1).	[11]

References

• [1] Cancer/testis antigen CT45: analysis of mRNA and protein expression in human cancer.Int J Cancer. 2009 Jun 15;124(12):2893-8. doi: 10.1002/ijc.24296.
• [2] CT45A1 acts as a new proto-oncogene to trigger tumorigenesis and cancer metastasis.Cell Death Dis. 2014 Jun 5;5(6):e1285. doi: 10.1038/cddis.2014.244.
• [3] Multi-level Proteomics Identifies CT45 as a Chemosensitivity Mediator and Immunotherapy Target in Ovarian Cancer.Cell. 2018 Sep 20;175(1):159-170.e16. doi: 10.1016/j.cell.2018.08.065.
• [4] Potential for adaptive dose escalation in radiotherapy for patients with locally advanced non-small-cell lung cancer in a low mid income setting.Br J Radiol. 2017 Feb;90(1070):20140234. doi: 10.1259/bjr.20140234. Epub 2017 Jan 3.
• [5] Chromosome X-encoded cancer/testis antigens show distinctive expression patterns in developing gonads and in testicular seminoma.Hum Reprod. 2011 Dec;26(12):3232-43. doi: 10.1093/humrep/der330. Epub 2011 Oct 20.
• [6] CT45A1 siRNA silencing suppresses the proliferation, metastasis and invasion of lung cancer cells by downregulating the ERK/CREB signaling pathway.Mol Med Rep. 2017 Nov;16(5):6708-6714. doi: 10.3892/mmr.2017.7466. Epub 2017 Sep 12.
• [7] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [8] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [9] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.