Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT81V4LS)

• DOT Name: Testis-specific gene 13 protein (TSGA13)
• Gene Name: TSGA13
• Related Disease:
  Adult glioblastoma
  Glioblastoma multiforme
  Lung cancer
  Lung carcinoma
  Hirschsprung disease
• UniProt ID: TSG13_HUMAN
• Pfam ID: PF14994
• Sequence:
  MSQKRQTKFQNGKSKTSENSSAKREKGMVVNSKEISDAVGQSKFVLENLRHYTVHPNLAQ
  YYKPLKATALQKFLAQNRKNTSFMLKVTQYDQDKTLLIMTNNPPPCSITQQDKESASKYF
  SKELLLKVMESHHQHKPTENLWLPRMPQKKKLRSKLKPIFPLILSDDPTSKREQWFRFST
  DNDFKSEGKYSKVYALRTQKKMYPQLTFAPVHERDMRKDASKKSASERPISKVIREPLTL
  ASLLEDMPTRTAPGESAFRNGRAPQWIIKKATVIG
• Tissue Specificity: Testis-specific.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	moderate	Altered Expression	[1]
Glioblastoma multiforme	DISK8246	moderate	Altered Expression	[1]
Lung cancer	DISCM4YA	moderate	Altered Expression	[1]
Lung carcinoma	DISTR26C	moderate	Altered Expression	[1]
Hirschsprung disease	DISUUSM1	Limited	Genetic Variation	[2]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Testis-specific gene 13 protein (TSGA13).	[3]

References

• [1] Histochemical analysis of testis specific gene 13 in human normal and malignant tissues.Cell Tissue Res. 2015 Dec;362(3):653-63. doi: 10.1007/s00441-015-2227-3. Epub 2015 Jun 27.
• [2] Potential association between TSGA13 variants and risk of total colonic aganglionosis in Hirschsprung disease.Gene. 2019 Aug 20;710:240-245. doi: 10.1016/j.gene.2019.06.007. Epub 2019 Jun 7.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.