Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8E7VBS)

• DOT Name: phospholipase A2 inhibitor and Ly6/PLAUR domain-containing protein (PINLYP)
• Gene Name: PINLYP
• UniProt ID: PINLY_HUMAN
• Pfam ID: PF02988 ; PF00021
• Sequence:
  MRLSRRPETFLLAFVLLCTLLGLGCPLHCEICTAAGSRCHGQMKTCSSDKDTCVLLVGKA
  TSKGKELVHTYKGCIRSQDCYSGVISTTMGPKDHMVTSSFCCQSDGCNSAFLSVPLTNLT
  ENGLMCPACTASFRDKCMGPMTHCTGKENHCVSLSGHVQAGIFKPRFAMRGCATESMCFT
  KPGAEVPTGTNVLFLHHIECTHSP

Molecular Interaction Atlas (MIA) of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of phospholipase A2 inhibitor and Ly6/PLAUR domain-containing protein (PINLYP).	[1]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of phospholipase A2 inhibitor and Ly6/PLAUR domain-containing protein (PINLYP).	[2]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of phospholipase A2 inhibitor and Ly6/PLAUR domain-containing protein (PINLYP).	[3]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of phospholipase A2 inhibitor and Ly6/PLAUR domain-containing protein (PINLYP).	[4]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of phospholipase A2 inhibitor and Ly6/PLAUR domain-containing protein (PINLYP).	[5]

References

• [1] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [2] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [3] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [4] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [5] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.