Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8RP8JB)

DOT Name	Signal recognition particle 19 kDa protein (SRP19)
Synonyms	SRP19
Gene Name	SRP19
Related Disease	Familial adenomatous polyposis ( ) Systemic lupus erythematosus ( )
UniProt ID	SRP19_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	1JID; 1MFQ; 1RY1; 2J37; 3KTV; 4P3E; 5M73; 7NFX; 7QWQ
Pfam ID	PF01922
Sequence	MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNV FLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQ KTGGADQSLQQGEGSKKGKGKKKK
Function	Component of the signal recognition particle (SRP) complex, a ribonucleoprotein complex that mediates the cotranslational targeting of secretory and membrane proteins to the endoplasmic reticulum (ER). Binds directly to 7SL RNA. Mediates binding of SRP54 to the SRP complex.
KEGG Pathway	Protein export (hsa03060 )
Reactome Pathway	SRP-dependent cotranslational protein targeting to membrane (R-HSA-1799339 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Familial adenomatous polyposis	DISW53RE	Strong	Genetic Variation	[1]
Systemic lupus erythematosus	DISI1SZ7	Strong	Altered Expression	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Signal recognition particle 19 kDa protein (SRP19).	[3]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Signal recognition particle 19 kDa protein (SRP19).	[4]
Fenretinide	DMRD5SP	Phase 3	Fenretinide decreases the expression of Signal recognition particle 19 kDa protein (SRP19).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Signal recognition particle 19 kDa protein (SRP19).	[6]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Signal recognition particle 19 kDa protein (SRP19).	[7]
------------------------------------------------------------------------------------

References

1	Identification and characterization of the familial adenomatous polyposis coli gene.Cell. 1991 Aug 9;66(3):589-600. doi: 10.1016/0092-8674(81)90021-0.
2	Novel Autoantibodies Related to Cell Death and DNA Repair Pathways in Systemic Lupus Erythematosus.Genomics Proteomics Bioinformatics. 2019 Jun;17(3):248-259. doi: 10.1016/j.gpb.2018.11.004. Epub 2019 Sep 5.
3	Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
4	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
5	Regulation of lipocalin-2 gene by the cancer chemopreventive retinoid 4-HPR. Int J Cancer. 2006 Oct 1;119(7):1599-606.
6	Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
7	Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.