Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT93VTU4)

• DOT Name: Spindlin-2A (SPIN2A)
• Synonyms: Protein DXF34; Spindlin-like protein 2A; SPIN-2; SPIN-2A
• Gene Name: SPIN2A
• Related Disease: Incontinentia pigmenti
• UniProt ID: SPI2A_HUMAN
• Pfam ID: PF02513
• Sequence:
  MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQKKQRGRPSSQPRRNIVGCRISHGWKE
  GDEPITQWKGTVLDQVPINPSLYLVKYDGIDCVYGLELHRDERVLSLKILSDRVASSHIS
  DANLANTIIGKAVEHMFEGEHGSKDEWRGMVLAQAPIMKAWFYITYEKDPVLYMYQLLDD
  YKEGDLRIMPESSESPPTEREPGGVVDGLIGKHVEYTKEDGSKRIGMVIHQVETKPSVYF
  IKFDDDFHIYVYDLVKKS
• Function: May be involved in the regulation of cell cycle progression. Exhibits H3K4me3-binding activity.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Incontinentia pigmenti	DIS0ALLE	Strong	Genetic Variation	[1]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Spindlin-2A (SPIN2A).	[2]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Spindlin-2A (SPIN2A).	[3]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Spindlin-2A (SPIN2A).	[5]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Spindlin-2A (SPIN2A).	[4]

References

• [1] A 2-Mb YAC contig encompassing three loci (DXF34, DXS14, and DXS390) that lie between Xp11.2 translocation breakpoints associated with incontinentia pigmenti type 1.Genomics. 1994 Apr;20(3):341-6. doi: 10.1006/geno.1994.1186.
• [2] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [3] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.