Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9GJBI3)

• DOT Name: Spermatogenesis-associated protein 16 (SPATA16)
• Synonyms: Testis development protein NYD-SP12
• Gene Name: SPATA16
• Related Disease:
  Hepatitis C virus infection
  Male infertility
  Spermatogenic failure 9
  Male infertility due to globozoospermia
  Spermatogenic failure 6
• UniProt ID: SPT16_HUMAN
• Pfam ID: PF15015
• Sequence:
  MDAGSSRSLENAVNRIYHDQLVPKINTSKKMSTLAHPPNILEMSQEIKKNCGGKQVEITL
  ERTKMTKGIKEKQSNDLEKAAFKRKAEGEEKPTRKKQAKITELDNQLITMPLPHIPLKNI
  MDVEMKLVYIDEMGVRYEFVESFMSTGSQPTCQAAEIVDPLSVHNFSFLPQIDKWLQVAL
  KDASSCYRQKKYALAAGQFRTALELCSKGAVLGEPFDAPAEDIASVASFIETKLVTCYLR
  MRKPDLALNHAHRSIVLNPAYFRNHLRQATVFRCLERYSEAARSAMIADYMFWLGGGREE
  SISKLIKLYWQAMIEEAITRAESFSVMYTPFATKIRADKIEKVKDAFTKTHPAYAEYMYT
  DLQALHMLPQTVDWSSFPPQQYLLTLGFKNKDDGKFLEKISSRKLPIFTEHKTPFGLTRE
  DTVRQMETMGKRILPILDFIRSTQLNGSFPASSGVMEKLQYASLLSQLQRVKEQSQVINQ
  AMAELATIPYLQDISQQEAELLQSLMADAMDTLEGRRNNNERVWNMIQKVGQIEDFLYQL
  EDSFLKTKKLRTARRQKTKMKRLQTVQQR
• Function: Essential for spermiogenesis and male fertility. Involved in the formation of sperm acrosome during spermatogenesis.
• Tissue Specificity: Expressed in testis.

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hepatitis C virus infection	DISQ0M8R	Strong	Genetic Variation	[1]
Male infertility	DISY3YZZ	Strong	Genetic Variation	[2]
Spermatogenic failure 9	DISJEBH2	Strong	Genetic Variation	[3]
Male infertility due to globozoospermia	DIS7EMCO	Supportive	Autosomal recessive	[2]
Spermatogenic failure 6	DISCK87Z	Limited	Autosomal recessive	[2]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Spermatogenesis-associated protein 16 (SPATA16).	[4]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Spermatogenesis-associated protein 16 (SPATA16).	[5]

References

• [1] Impact of IFNL4 Genetic Variants on Sustained Virologic Response and Viremia in Hepatitis C Virus Genotype 3 Patients.J Interferon Cytokine Res. 2019 Oct;39(10):642-649. doi: 10.1089/jir.2019.0013. Epub 2019 Jul 1.
• [2] Homozygous mutation in SPATA16 is associated with male infertility in human globozoospermia. Am J Hum Genet. 2007 Oct;81(4):813-20. doi: 10.1086/521314. Epub 2007 Aug 21.
• [3] Comparison of sperm morphology and nuclear sperm quality in SPATA16- and DPY19L2-mutated globozoospermic patients.Andrologia. 2019 Jul;51(6):e13277. doi: 10.1111/and.13277. Epub 2019 Mar 26.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.