Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9R1LF7)

DOT Name	Fructose-1,6-bisphosphatase isozyme 2 (FBP2)
Synonyms	FBPase 2; EC 3.1.3.11; D-fructose-1,6-bisphosphate 1-phosphohydrolase 2; Muscle FBPase
Gene Name	FBP2
Related Disease	Gastric cancer ( ) Malignant soft tissue neoplasm ( ) Neoplasm ( ) Recessive X-linked ichthyosis ( ) Sarcoma ( ) Stomach cancer ( ) Rett syndrome ( )
UniProt ID	F16P2_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	3IFA; 3IFC; 4HE0; 4HE1; 4HE2; 5ET5; 5ET6; 5ET7; 5ET8; 5K54; 5K55; 5K56; 5L0A; 5Q0C
EC Number	3.1.3.11
Pfam ID	PF00316 ; PF18913
Sequence	MTDRSPFETDMLTLTRYVMEKGRQAKGTGELTQLLNSMLTAIKAISSAVRKAGLAHLYGI AGSVNVTGDEVKKLDVLSNSLVINMVQSSYSTCVLVSEENKDAIITAKEKRGKYVVCFDP LDGSSNIDCLASIGTIFAIYRKTSEDEPSEKDALQCGRNIVAAGYALYGSATLVALSTGQ GVDLFMLDPALGEFVLVEKDVKIKKKGKIYSLNEGYAKYFDAATTEYVQKKKFPEDGSAP YGARYVGSMVADVHRTLVYGGIFLYPANQKSPKGKLRLLYECNPVAYIIEQAGGLATTGT QPVLDVKPEAIHQRVPLILGSPEDVQEYLTCVQKNQAGS
Function	Catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate in the presence of divalent cations and probably participates in glycogen synthesis from carbohydrate precursors, such as lactate.
Tissue Specificity	Expressed in skeletal muscle (at protein level).
KEGG Pathway	Glycolysis / Gluconeogenesis (hsa00010 ) Pentose phosphate pathway (hsa00030 ) Fructose and mannose metabolism (hsa00051 ) Metabolic pathways (hsa01100 ) Carbon metabolism (hsa01200 ) AMPK sig.ling pathway (hsa04152 ) Insulin sig.ling pathway (hsa04910 ) Glucagon sig.ling pathway (hsa04922 )
Reactome Pathway	Gluconeogenesis (R-HSA-70263 )
BioCyc Pathway	MetaCyc:HS05462-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Gastric cancer	DISXGOUK	Strong	Altered Expression	[1]
Malignant soft tissue neoplasm	DISTC6NO	Strong	Altered Expression	[2]
Neoplasm	DISZKGEW	Strong	Altered Expression	[1]
Recessive X-linked ichthyosis	DISZY56W	Strong	Biomarker	[2]
Sarcoma	DISZDG3U	Strong	Altered Expression	[2]
Stomach cancer	DISKIJSX	Strong	Altered Expression	[1]
Rett syndrome	DISGG5UV	Limited	Biomarker	[3]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Fructose-1,6-bisphosphatase isozyme 2 (FBP2).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Fructose-1,6-bisphosphatase isozyme 2 (FBP2).	[5]
------------------------------------------------------------------------------------

References

1	Decreased fructose-1,6-bisphosphatase-2 expression promotes glycolysis and growth in gastric cancer cells.Mol Cancer. 2013 Sep 25;12(1):110. doi: 10.1186/1476-4598-12-110.
2	Fructose-1,6-Bisphosphatase 2 Inhibits Sarcoma Progression by Restraining Mitochondrial Biogenesis.Cell Metab. 2020 Jan 7;31(1):174-188.e7. doi: 10.1016/j.cmet.2019.10.012. Epub 2019 Nov 21.
3	Reduced folate transport to the CNS in female Rett patients.Neurology. 2003 Aug 26;61(4):506-15. doi: 10.1212/01.wnl.0000078939.64774.1b.
4	Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
5	Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.