Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTA137WF)

• DOT Name: Secretoglobin family 1C member 1 (SCGB1C1)
• Synonyms: Secretoglobin RYD5
• Gene Name: SCGB1C1
• Related Disease:
  Asthma
  Nasal polyp
• UniProt ID: SG1C1_HUMAN
• Pfam ID: PF01099
• Sequence:
  MKGSRALLLVALTLFCICRMATGEDNDEFFMDFLQTLLVGTPEELYEGTLGKYNVNEDAK
  AAMTELKSCIDGLQPMHKAELVKLLVQVLGSQDGA

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Asthma	DISW9QNS	Strong	Genetic Variation	[1]
Nasal polyp	DISLP3XE	Strong	Genetic Variation	[1]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Secretoglobin family 1C member 1 (SCGB1C1).	[2]
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Secretoglobin family 1C member 1 (SCGB1C1).	[3]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Secretoglobin family 1C member 1 (SCGB1C1).	[4]

References

• [1] Single-Nucleotide Polymorphisms on the RYD5 Gene in Nasal Polyposis.DNA Cell Biol. 2015 Oct;34(10):633-42. doi: 10.1089/dna.2015.2897. Epub 2015 Jul 23.
• [2] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [3] Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.