Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTA20BF2)

DOT Name	Secretoglobin family 1D member 1 (SCGB1D1)
Synonyms	Lipophilin-A
Gene Name	SCGB1D1
Related Disease	Neoplasm ( )
UniProt ID	SG1D1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF01099
Sequence	MRLSVCLLLLTLALCCYRANAVVCQALGSEITGFLLAGKPVFKFQLAKFKAPLEAVAAKM EVKKCVDTMAYEKRVLITKTLGKIAEKCDR
Function	May bind androgens and other steroids, may also bind estramustine, a chemotherapeutic agent used for prostate cancer. May be under transcriptional regulation of steroid hormones.
Tissue Specificity	Expressed in lachrymal gland, thymus, kidney, testis, ovary and salivary gland.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Neoplasm	DISZKGEW	Limited	Altered Expression	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Secretoglobin family 1D member 1 (SCGB1D1).	[2]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Secretoglobin family 1D member 1 (SCGB1D1).	[3]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Secretoglobin family 1D member 1 (SCGB1D1).	[4]
------------------------------------------------------------------------------------

References

1	Evaluation of lipophilins as determinants of tumor cell response to estramustine.J Pharmacol Exp Ther. 2005 Dec;315(3):1158-62. doi: 10.1124/jpet.105.090860. Epub 2005 Aug 24.
2	Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
3	Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.
4	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.