Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAMUC7H)

• DOT Name: Homeobox protein Nkx-6.3 (NKX6-3)
• Gene Name: NKX6-3
• Related Disease:
  B-cell lymphoma
  Follicular lymphoma
• UniProt ID: NKX63_HUMAN
• Pfam ID: PF00046
• Sequence:
  MESNLQGTFLLNNTPLAQFPEMKAPVCQYSVQNSFYKLSPPGLGPQLAAGTPHGITDILS
  RPVAAPNNSLLSGYPHVAGFGGLSSQGVYYSPQVGNFSKAGNEYPTRTRNCWADTGQDWR
  GGRQCSNTPDPLSDSIHKKKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTE
  SQVKVWFQNRRTKWRKKSALEPSSSTPRAPGGAGAGAGGDRAPSENEDDEYNKPLDPDSD
  DEKIRLLLRKHRAAFSVLSLGAHSV
• Function: Putative transcription factor, which may be involved in patterning of central nervous system and pancreas.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
B-cell lymphoma	DISIH1YQ	Strong	Altered Expression	[1]
Follicular lymphoma	DISVEUR6	Strong	Altered Expression	[1]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Homeobox protein Nkx-6.3 (NKX6-3).	[2]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Homeobox protein Nkx-6.3 (NKX6-3).	[3]

References

• [1] NKL homeobox gene activities in B-cell development and lymphomas.PLoS One. 2018 Oct 11;13(10):e0205537. doi: 10.1371/journal.pone.0205537. eCollection 2018.
• [2] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.