Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTB44YPE)

• DOT Name: Serpin B12 (SERPINB12)
• Gene Name: SERPINB12
• Related Disease: Eosinophilic esophagitis
• UniProt ID: SPB12_HUMAN
• Pfam ID: PF00079
• Sequence:
  MDSLVTANTKFCFDLFQEIGKDDRHKNIFFSPLSLSAALGMVRLGARSDSAHQIDEVLHF
  NEFSQNESKEPDPCLKSNKQKAGSLNNESGLVSCYFGQLLSKLDRIKTDYTLSIANRLYG
  EQEFPICQEYLDGVIQFYHTTIESVDFQKNPEKSRQEINFWVECQSQGKIKELFSKDAIN
  AETVLVLVNAVYFKAKWETYFDHENTVDAPFCLNANENKSVKMMTQKGLYRIGFIEEVKA
  QILEMRYTKGKLSMFVLLPSHSKDNLKGLEELERKITYEKMVAWSSSENMSEESVVLSFP
  RFTLEDSYDLNSILQDMGITDIFDETRADLTGISPSPNLYLSKIIHKTFVEVDENGTQAA
  AATGAVVSERSLRSWVEFNANHPFLFFIRHNKTQTILFYGRVCSP
• Function: Inhibits trypsin and plasmin, but not thrombin, coagulation factor Xa, or urokinase-type plasminogen activator. May play a role in cell differentiation.
• Tissue Specificity: Expressed in many tissues, including brain, bone marrow, lymph node, heart, lung, liver, pancreas, testis, ovary, and intestine.
• Reactome Pathway: Neutrophil degranulation (R-HSA-6798695)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Eosinophilic esophagitis	DISR8WSB	Limited	Biomarker	[1]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Serpin B12 (SERPINB12).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the mutagenesis of Serpin B12 (SERPINB12).	[3]

References

• [1] SERPINB12 as a possible marker of steroid dependency in children with eosinophilic esophagitis: A pilot study.Dig Liver Dis. 2020 Feb;52(2):158-163. doi: 10.1016/j.dld.2019.08.018. Epub 2019 Oct 23.
• [2] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [3] Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.