Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTB6NJWC)

DOT Name	Probable inactive serine protease 37 (PRSS37)
Synonyms	Probable inactive trypsin-X2
Gene Name	PRSS37
Related Disease	Male infertility ( )
UniProt ID	PRS37_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00089
Sequence	MKYVFYLGVLAGTFFFADSSVQKEDPAPYLVYLKSHFNPCVGVLIKPSWVLAPAHCYLPN LKVMLGNFKSRVRDGTEQTINPIQIVRYWNYSHSAPQDDLMLIKLAKPAMLNPKVQPLTL ATTNVRPGTVCLLSGLDWSQENSGRHPDLRQNLEAPVMSDRECQKTEQGKSHRNSLCVKF VKVFSRIFGEVAVATVICKDKLQGIEVGHFMGGDVGIYTNVYKYVSWIENTAKDK
Function	Plays a role in male fertility. May have a role in sperm migration or binding to zona-intact eggs. Involved in the activation of the proacrosin/acrosin system.
Tissue Specificity	Testis-specific . Expressed in spermatids (at protein level) .

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Male infertility	DISY3YZZ	Strong	Biomarker	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Probable inactive serine protease 37 (PRSS37).	[2]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Probable inactive serine protease 37 (PRSS37).	[4]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Folic acid	DMEMBJC	Approved	Folic acid decreases the expression of Probable inactive serine protease 37 (PRSS37).	[3]
------------------------------------------------------------------------------------

References

1	Low levels of PRSS37 protein in sperm are associated with many cases of unexplained male infertility.Acta Biochim Biophys Sin (Shanghai). 2016 Nov;48(11):1058-1065. doi: 10.1093/abbs/gmw096. Epub 2016 Sep 20.
2	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3	Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
4	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.