Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTB7O3UJ)
DOT Name | Rab-like protein 2B (RABL2B) | ||||
---|---|---|---|---|---|
Gene Name | RABL2B | ||||
UniProt ID | |||||
3D Structure | |||||
Pfam ID | |||||
Sequence |
MAEDKTKPSELDQGKYDADDNVKIICLGDSAVGKSKLMERFLMDGFQPQQLSTYALTLYK
HTATVDGRTILVDFWDTAGQERFQSMHASYYHKAHACIMVFDVQRKVTYRNLSTWYTELR EFRPEIPCIVVANKIDDINVTQKSFNFAKKFSLPLYFVSAADGTNVVKLFNDAIRLAVSY KQNSQDFMDEIFQELENFSLEQEEEDVPDQEQSSSIETPSEEAASPHS |
||||
Function |
Small GTPase required for ciliation. Activated in a guanine nucleotide exchange factor (GEF)-independent manner via its intrinsic GDP for GTP nucleotide exchange ability. Involved in ciliary assembly by binding the intraflagellar transport (IFT) complex B from the large pool pre-docked at the base of the cilium and thus triggers its entry into the cilia.
|
||||
Tissue Specificity | Expressed in the testis. | ||||
Molecular Interaction Atlas (MIA) of This DOT
Molecular Interaction Atlas (MIA) | |||||||||||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
3 Drug(s) Affected the Gene/Protein Processing of This DOT
|
|||||||||||||||||||||||||||||||||||
References