Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBBPBG0)

DOT Name Golgin subfamily A member 1 (GOLGA1)
Synonyms Golgin-97
Gene Name GOLGA1
Related Disease
Advanced cancer ( )
Breast cancer ( )
Breast carcinoma ( )
Sjogren syndrome ( )
UniProt ID
GOGA1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF01465
Sequence
MFAKLKKKIAEETAVAQRPGGATRIPRSVSKESVASMGADSGDDFASDGSSSREDLSSQL
LRRNEQIRKLEARLSDYAEQVRNLQKIKEKLEIALEKHQDSSMRKFQEQNETFQANRAKM
AEGLALALARKDQEWSEKMDQLEKEKNILTAQLQEMKNQSMNLFQRRDEMDELEGFQQQE
LSKIKHMLLKKEESLGKMEQELEARTRELSRTQEELMNSNQMSSDLSQKLEELQRHYSTL
EEQRDHVIASKTGAESKITALEQKEQELQALIQQLSIDLQKVTAETQEKEDVITHLQEKV
ASLEKRLEQNLSGEEHLQELLKEKTLAEQNLEDTRQQLLAARSSQAKAINTLETRVRELE
QTLQASEEQLQQSKGIVAAQETQIQELAAANQESSHVQQQALALEQQFLERTQALEAQIV
ALERTRAADQTTAEQGMRQLEQENAALKECRNEYERSLQNHQFELKKLKEEWSQREIVSV
AMAQALEEVRKQREEFQQQAANLTAIIDEKEQNLREKTEVLLQKEQEILQLERGHNSALL
QIHQLQAELEALRTLKAEEAAVVAEQEDLLRLRGPLQAEALSVNESHVTSRAMQDPVFQL
PTAGRTPNGEVGAMDLTQLQKEKQDLEQQLLEKNKTIKQMQQRMLELRKTLQKELKIRPD
NELFEVREKPGPEMANMAPSVTNNTDLTDAREINFEYLKHVVLKFMSCRESEAFHLIKAV
SVLLNFSQEEENMLKETLEYKMSWFGSKPAPKGSIRPSISNPRIPWS
Function Involved in vesicular trafficking at the Golgi apparatus level. Involved in endosome-to-Golgi trafficking.
Reactome Pathway
Retrograde transport at the Trans-Golgi-Network (R-HSA-6811440 )

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Altered Expression [1]
Breast cancer DIS7DPX1 Strong Altered Expression [1]
Breast carcinoma DIS2UE88 Strong Altered Expression [1]
Sjogren syndrome DISUBX7H Strong Biomarker [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Golgin subfamily A member 1 (GOLGA1). [3]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Golgin subfamily A member 1 (GOLGA1). [4]
Testosterone enanthate DMB6871 Approved Testosterone enanthate affects the expression of Golgin subfamily A member 1 (GOLGA1). [5]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Golgin subfamily A member 1 (GOLGA1). [6]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Golgin subfamily A member 1 (GOLGA1). [7]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 increases the phosphorylation of Golgin subfamily A member 1 (GOLGA1). [8]
------------------------------------------------------------------------------------

References

1 Golgi tethering factor golgin-97 suppresses breast cancer cell invasiveness by modulating NF-B activity.Cell Commun Signal. 2018 Apr 27;16(1):19. doi: 10.1186/s12964-018-0230-5.
2 Molecular cloning of a novel 97-kd Golgi complex autoantigen associated with Sjgren's syndrome.Arthritis Rheum. 1997 Sep;40(9):1693-702. doi: 10.1002/art.1780400920.
3 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
4 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5 Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
6 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
7 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
8 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.