Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBJO30D)

• DOT Name: Choriogonadotropin subunit beta 7 (CGB7)
• Gene Name: CGB7
• Related Disease:
  Breast neoplasm
  Neoplasm
• UniProt ID: CGB7_HUMAN
• Pfam ID: PF00007
• Sequence:
  MEMFQGLLLLLLLSMGGTWASREMLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPT
  MTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDC
  GGPKDHPLTCDDPRFQASSSSKAPPPSLPSPSRLPGPSDTPILPQ
• Function: Beta subunit of the human chorionic gonadotropin (hCG). hCG is a complex glycoprotein composed of two glycosylated subunits alpha and beta which are non-covalently associated. The alpha subunit is identical to those in the pituitary gonadotropin hormones (LH, FSH and TSH). The beta subunits are distinct in each of the hormones and confer receptor and biological specificity. Has an essential role for pregnancy and maternal adaptation. Stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy.
• Tissue Specificity: High expression in the placenta throughout pregnancy.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[1]
Neoplasm	DISZKGEW	Limited	Biomarker	[2]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Choriogonadotropin subunit beta 7 (CGB7).	[3]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Choriogonadotropin subunit beta 7 (CGB7).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Choriogonadotropin subunit beta 7 (CGB7).	[5]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol decreases the expression of Choriogonadotropin subunit beta 7 (CGB7).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Choriogonadotropin subunit beta 7 (CGB7).	[7]
Forskolin	DM6ITNG	Investigative	Forskolin increases the expression of Choriogonadotropin subunit beta 7 (CGB7).	[8]

References

• [1] Analysis of the human CGB/LHB gene cluster in breast tumors by real-time quantitative RT-PCR assays.Cancer Lett. 2001 Jul 10;168(1):93-100. doi: 10.1016/s0304-3835(01)00496-7.
• [2] Human chorionic gonadotropin beta subunit genes CGB1 and CGB2 are transcriptionally active in ovarian cancer.Int J Mol Sci. 2013 Jun 17;14(6):12650-60. doi: 10.3390/ijms140612650.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [5] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [6] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [7] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [8] Exposure to perfluorobutane sulfonate and perfluorooctanesulfonic acid disrupts the production of angiogenesis factors and stress responses in human placental syncytiotrophoblast. Reprod Toxicol. 2020 Dec;98:269-277. doi: 10.1016/j.reprotox.2020.10.013. Epub 2020 Nov 2.