Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBZITLI)

• DOT Name: Armadillo repeat-containing X-linked protein 5 (ARMCX5)
• Gene Name: ARMCX5
• UniProt ID: ARMX5_HUMAN
• Pfam ID: PF04826
• Sequence:
  MVDSGTEARARGKAEAGLQDGISGPATARVNGKTQAEAVAEAELKTESVTQAKAGDGAMT
  RTHTVTYREAMAVTREVIKVEDTTKTRVMVETKTKPLAERSIVPQTKSKAMPMSRVSTVT
  KSEVKVVAVIEANIRSYAKSHDKANTGSRPDRREETSIGMKSSDEDEENICSWFWTGEEP
  SVGSWFWPEEETSLQVYKPLPKIQEKPKPTHKPTLTIKQKVIAWSRARYIVLVPVEGGEQ
  SLPPEGNWTLVETLIETPLGIRPLTKIPPYHGPYYQTLAEIKKQIRQREKYGPNPKACHC
  KSRGFSLEPKEFDKLVALLKLTKDPFIHEIATMIMGISPAYPFTQDIIHDVGITVMIENL
  VNNPNVKEHPGALSMVDDSSESSEEPKSGESYIHQVCKGIISCPLNSPVQLAGLKLLGHL
  SIKFEDHYVITSYIPDFLTLLNKGSVKTKFYVLKVFSCLSKNHANTRELISAKVLSSLVA
  PFNKNESKANILNIIEIFENINFQFKTKAKLFTKEKFTKSELISIFQEAKQFGQKLQDLA
  EHSDPEVRDKVIRLILKL

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Armadillo repeat-containing X-linked protein 5 (ARMCX5).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Armadillo repeat-containing X-linked protein 5 (ARMCX5).	[7]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Armadillo repeat-containing X-linked protein 5 (ARMCX5).	[8]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Armadillo repeat-containing X-linked protein 5 (ARMCX5).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Armadillo repeat-containing X-linked protein 5 (ARMCX5).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Armadillo repeat-containing X-linked protein 5 (ARMCX5).	[4]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Armadillo repeat-containing X-linked protein 5 (ARMCX5).	[5]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Armadillo repeat-containing X-linked protein 5 (ARMCX5).	[6]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [6] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [8] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.