Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDKK15V)

DOT Name Transcription factor BTF3 homolog 4 (BTF3L4)
Synonyms Basic transcription factor 3-like 4
Gene Name BTF3L4
UniProt ID
BT3L4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF01849
Sequence
MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQSSLKKLAVNNIAGIEEVNMI
KDDGTVIHFNNPKVQASLSANTFAITGHAEAKPITEMLPGILSQLGADSLTSLRKLAEQF
PRQVLDSKAPKPEDIDEEDDDVPDLVENFDEASKNEAN

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Transcription factor BTF3 homolog 4 (BTF3L4). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Transcription factor BTF3 homolog 4 (BTF3L4). [2]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Transcription factor BTF3 homolog 4 (BTF3L4). [3]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Transcription factor BTF3 homolog 4 (BTF3L4). [4]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Transcription factor BTF3 homolog 4 (BTF3L4). [5]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Transcription factor BTF3 homolog 4 (BTF3L4). [6]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Transcription factor BTF3 homolog 4 (BTF3L4). [7]
Trichostatin A DM9C8NX Investigative Trichostatin A affects the expression of Transcription factor BTF3 homolog 4 (BTF3L4). [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
4 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
5 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
6 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
7 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
8 A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.