Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTDKV8V8)

• DOT Name: GTPase IMAP family member 6 (GIMAP6)
• Synonyms: Immunity-associated nucleotide 2 protein; IAN-2; hIAN2; Immunity-associated nucleotide 6 protein; IAN-6; hIAN6
• Gene Name: GIMAP6
• Related Disease:
  Hepatocellular carcinoma
  Neoplasm
• UniProt ID: GIMA6_HUMAN
• Pfam ID: PF04548
• Sequence:
  MEEEEYEQIPQENPPEELSQDPVLELSGGLREKEQKTPRRLRLILMGKTGSGKSATGNSI
  LGRDVFESKLSTRPVTKTSQRRSREWAGKELEVIDTPNILSPQVSPEVADAICQAIVLSA
  PGPHAVLLVTQLGRFTDEDQQVVRRLQEVFGVGVLGHTILVFTRKEDLAGGSLEDYVRET
  NNQALAWLDVTLARRHCGFNNRAQGEEQEAQLRELMEKVEAIMWENEGDYYSNKAYQYTQ
  QNFRLKELQERQVSQGQGSEDVPGEESWLEGLSQIQKESEEAHRCLLGKADL
• Tissue Specificity: Highly expressed in spleen, lymph nodes, lung and placenta. Expressed at moderate level in thymus, kidney, heart and digestive tract. Weakly expressed in other lymphoid tissues. Detected in T-cells.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[1]
Neoplasm	DISZKGEW	Strong	Altered Expression	[1]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of GTPase IMAP family member 6 (GIMAP6).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of GTPase IMAP family member 6 (GIMAP6).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of GTPase IMAP family member 6 (GIMAP6).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of GTPase IMAP family member 6 (GIMAP6).	[5]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of GTPase IMAP family member 6 (GIMAP6).	[6]
QUERCITRIN	DM1DH96	Investigative	QUERCITRIN increases the expression of GTPase IMAP family member 6 (GIMAP6).	[7]

References

• [1] Dysregulation of GTPase IMAP family members in hepatocellular cancer.Mol Med Rep. 2016 Nov;14(5):4119-4123. doi: 10.3892/mmr.2016.5764. Epub 2016 Sep 22.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [6] Arsenic suppresses gene expression in promyelocytic leukemia cells partly through Sp1 oxidation. Blood. 2005 Jul 1;106(1):304-10.
• [7] Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.