Details of Drug Off-Target (DOT)
General Information of Drug Off-Target (DOT) (ID: OTDLYU1I)
DOT Name | Beta-defensin 127 (DEFB127) | ||||
---|---|---|---|---|---|
Synonyms | Beta-defensin 27; DEFB-27; Defensin, beta 127 | ||||
Gene Name | DEFB127 | ||||
Related Disease | |||||
UniProt ID | |||||
3D Structure | |||||
Pfam ID | |||||
Sequence |
MGLFMIIAILLFQKPTVTEQLKKCWNNYVQGHCRKICRVNEVPEALCENGRYCCLNIKEL
EACKKITKPPRPKPATLALTLQDYVTIIENFPSLKTQST |
||||
Function | Has antibacterial activity. | ||||
Reactome Pathway | |||||
Molecular Interaction Atlas (MIA) of This DOT
1 Disease(s) Related to This DOT
|
||||||||||||||||||||||||||
Molecular Interaction Atlas (MIA) | ||||||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
1 Drug(s) Affected the Gene/Protein Processing of This DOT
|
||||||||||||||||||||||||||
References