Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEPTEZ3)

• DOT Name: Transcription initiation factor TFIID subunit 10 (TAF10)
• Synonyms: STAF28; Transcription initiation factor TFIID 30 kDa subunit; TAF(II)30; TAFII-30; TAFII30
• Gene Name: TAF10
• UniProt ID: TAF10_HUMAN
• PDB ID: 2F69 ; 3M53 ; 3M54 ; 3M55 ; 3M56 ; 3M57 ; 3M58 ; 3M59 ; 3M5A ; 4J7F ; 4J7I ; 4J83 ; 4J8O ; 4WV4 ; 5EG2 ; 6MZC ; 6MZD ; 6MZL ; 6MZM ; 7EDX ; 7EG7 ; 7EG8 ; 7EG9 ; 7EGA ; 7EGB ; 7EGC ; 7EGD ; 7EGE ; 7EGF ; 7EGG ; 7EGI ; 7EGJ ; 7ENA ; 7ENC ; 7KTR ; 7KTS ; 8GXQ ; 8GXS ; 8H7G ; 8WAK ; 8WAL ; 8WAN ; 8WAO ; 8WAP ; 8WAQ ; 8WAR ; 8WAS
• Pfam ID: PF03540
• Sequence:
  MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGG
  TGPLAARAGEPAERRGAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFL
  MQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTA
  SGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT
• Function: The TFIID basal transcription factor complex plays a major role in the initiation of RNA polymerase II (Pol II)-dependent transcription. TFIID recognizes and binds promoters with or without a TATA box via its subunit TBP, a TATA-box-binding protein, and promotes assembly of the pre-initiation complex (PIC). The TFIID complex consists of TBP and TBP-associated factors (TAFs), including TAF1, TAF2, TAF3, TAF4, TAF5, TAF6, TAF7, TAF8, TAF9, TAF10, TAF11, TAF12 and TAF13. TAF10 is also component of the PCAF histone acetylase complex, the TATA-binding protein-free TAF complex (TFTC) and the STAGA transcription coactivator-HAT complex. May regulate cyclin E expression.
• KEGG Pathway: Basal transcription factors (hsa03022)
• Reactome Pathway:
  RNA Polymerase II HIV Promoter Escape (R-HSA-167162)
  Transcription of the HIV genome (R-HSA-167172)
  HATs acetylate histones (R-HSA-3214847)
  Ub-specific processing proteases (R-HSA-5689880)
  RNA Polymerase II Pre-transcription Events (R-HSA-674695)
  Regulation of TP53 Activity through Phosphorylation (R-HSA-6804756)
  RNA Polymerase II Promoter Escape (R-HSA-73776)
  RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (R-HSA-73779)
  RNA Polymerase II Transcription Initiation (R-HSA-75953)
  RNA Polymerase II Transcription Initiation And Promoter Clearance (R-HSA-76042)
  HIV Transcription Initiation (R-HSA-167161)

Molecular Interaction Atlas (MIA) of This DOT

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Transcription initiation factor TFIID subunit 10 (TAF10).	[1]
Selenium	DM25CGV	Approved	Selenium increases the expression of Transcription initiation factor TFIID subunit 10 (TAF10).	[2]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the expression of Transcription initiation factor TFIID subunit 10 (TAF10).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Transcription initiation factor TFIID subunit 10 (TAF10).	[3]

References

• [1] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [2] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [3] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.