Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEYGWSV)

• DOT Name: B-cell antigen receptor complex-associated protein beta chain (CD79B)
• Synonyms: B-cell-specific glycoprotein B29; Ig-beta; Immunoglobulin-associated B29 protein; CD antigen CD79b
• Gene Name: CD79B
• Related Disease:
  Agammaglobulinemia 6, autosomal recessive
  Autosomal agammaglobulinemia
• UniProt ID: CD79B_HUMAN
• PDB ID: 3KG5; 7WSO; 7WSP; 7XQ8; 7XT6
• Pfam ID: PF07686
• Sequence:
  MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFT
  VKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIY
  FCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLL
  LDKDDSKAGMEEDHTYEGLDIDQTATYEDIVTLRTGEVKWSVGEHPGQE
• Function: Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation.
• Tissue Specificity: B-cells.
• KEGG Pathway: B cell receptor sig.ling pathway (hsa04662)
• Reactome Pathway:
  Potential therapeutics for SARS (R-HSA-9679191)
  Antigen activates B Cell Receptor (BCR) leading to generation of second messengers (R-HSA-983695)
  CD22 mediated BCR regulation (R-HSA-5690714)

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Agammaglobulinemia 6, autosomal recessive	DIS9O6BJ	Definitive	Autosomal recessive	[1]
Autosomal agammaglobulinemia	DISRW8BT	Supportive	Autosomal dominant	[2]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of B-cell antigen receptor complex-associated protein beta chain (CD79B).	[3]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of B-cell antigen receptor complex-associated protein beta chain (CD79B).	[5]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of B-cell antigen receptor complex-associated protein beta chain (CD79B).	[4]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of B-cell antigen receptor complex-associated protein beta chain (CD79B).	[6]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of B-cell antigen receptor complex-associated protein beta chain (CD79B).	[7]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Mutations of the Igbeta gene cause agammaglobulinemia in man. J Exp Med. 2007 Sep 3;204(9):2047-51. doi: 10.1084/jem.20070264. Epub 2007 Aug 20.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [7] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.