Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFTD4WV)

DOT Name Modulator of macroautophagy TMEM150B (TMEM150B)
Synonyms Protein DRAM-3; Transmembrane protein 150B; Transmembrane protein 224
Gene Name TMEM150B
Related Disease
Major depressive disorder ( )
Female hypogonadism ( )
UniProt ID
T150B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF10277
Sequence
MWGYLSLMPVFLAVWAISGVWIVFAIAVTNRTVDLSKGFPYISICGSFPPQSCIFSQVLN
MGAALAAWICIVRYHQLRDWGVRRWPNQLILWTGLLCALGTSVVGNFQEKNQRPTHLAGA
FLAFILGNVYFWLQLLLWRLKRLPQPGAAWIGPLRLGLCSVCTILIVAMIVLHACSLRSV
SAACEWVVAMLLFALFGLLAVDFSALESCTLCVQPWPSLSPPPASPISLPVQL
Function
Modulator of macroautophagy that causes accumulation of autophagosomes under basal conditions and enhances autophagic flux. Represses cell death and promotes long-term clonogenic survival of cells grown in the absence of glucose in a macroautophagy-independent manner. May have some role in extracellular matrix engulfment or growth factor receptor recycling, both of which can modulate cell survival.
Tissue Specificity Highly expressed in the colon and lung with comparatively high levels also detectable in the lymph nodes, placenta, duodenum, peripheral blood mononuclear cells and spleen .

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Major depressive disorder DIS4CL3X Strong Genetic Variation [1]
Female hypogonadism DISWASB4 Limited Genetic Variation [2]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Modulator of macroautophagy TMEM150B (TMEM150B). [3]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Modulator of macroautophagy TMEM150B (TMEM150B). [4]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Modulator of macroautophagy TMEM150B (TMEM150B). [5]
------------------------------------------------------------------------------------

References

1 The PHF21B gene is associated with major depression and modulates the stress response.Mol Psychiatry. 2017 Jul;22(7):1015-1025. doi: 10.1038/mp.2016.174. Epub 2016 Oct 25.
2 Variation analysis of theTMEM150B gene in Chinese women with premature ovarian insufficiency.Reprod Biomed Online. 2019 Mar;38(3):407-412. doi: 10.1016/j.rbmo.2018.12.009. Epub 2018 Dec 21.
3 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
4 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
5 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.