Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTG8UM2N)

DOT Name UL16-binding protein 6 (RAET1L)
Synonyms Retinoic acid early transcript 1L protein
Gene Name RAET1L
Related Disease
Alopecia areata ( )
UniProt ID
ULBP6_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
4S0U
Pfam ID
PF00129
Sequence
MAAAAIPALLLCLPLLFLLFGWSRARRDDPHSLCYDITVIPKFRPGPRWCAVQGQVDEKT
FLHYDCGNKTVTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLT
LQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAM
SFHYISMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRATATTLILCCLLIILPC
FILPGI
Function Binds and activates the KLRK1/NKG2D receptor, mediating natural killer cell cytotoxicity.
Tissue Specificity
Widely expressed . Expressed in trachea . Constitutively expressed in peripheral blood mononuclear cells, including B-cells and natural killer cells, as well as CD4+ and CD8+ T-cells and monocytes. Tends to be up-regulated in various lymphoid malignancies, including chronic lymphocytic leukemia .
KEGG Pathway
.tural killer cell mediated cytotoxicity (hsa04650 )
Reactome Pathway
Post-translational modification (R-HSA-163125 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Alopecia areata DIS0XXBJ Limited Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Estradiol DMUNTE3 Approved Estradiol increases the expression of UL16-binding protein 6 (RAET1L). [2]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of UL16-binding protein 6 (RAET1L). [3]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of UL16-binding protein 6 (RAET1L). [4]
Milchsaure DM462BT Investigative Milchsaure affects the expression of UL16-binding protein 6 (RAET1L). [5]
------------------------------------------------------------------------------------

References

1 Genome-wide association study in alopecia areata implicates both innate and adaptive immunity.Nature. 2010 Jul 1;466(7302):113-7. doi: 10.1038/nature09114.
2 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
3 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
4 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
5 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.