Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGBTZFE)

• DOT Name: P antigen family member 2 (PAGE2)
• Synonyms: PAGE-2; G antigen family C 2; Prostate-associated gene 2 protein
• Gene Name: PAGE2
• UniProt ID: PAGE2_HUMAN
• Pfam ID: PF05831
• Sequence:
  MSELLRARSQSSERGNDQESSQPVGSVIVQEPTEEKRQEEEPPTDNQGIAPSGEIENQAV
  PAFQGPDMEAFQQELALLKIEDEPGDGPDVREGIMPTFDLTKVLEAGDAQP

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of P antigen family member 2 (PAGE2).	[1]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of P antigen family member 2 (PAGE2).	[2]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of P antigen family member 2 (PAGE2).	[3]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of P antigen family member 2 (PAGE2).	[4]

References

• [1] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [2] Characterization of DOK1, a candidate tumor suppressor gene, in epithelial ovarian cancer. Mol Oncol. 2011 Oct;5(5):438-53. doi: 10.1016/j.molonc.2011.07.003. Epub 2011 Jul 26.
• [3] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [4] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.