Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGGOSPW)

• DOT Name: Leucine zipper protein 2 (LUZP2)
• Gene Name: LUZP2
• Related Disease:
  Alzheimer disease
  Neoplasm
  Childhood kidney Wilms tumor
  Wilms tumor
• UniProt ID: LUZP2_HUMAN
• Sequence:
  MKFSPAHYLLPLLPALVLSTRQDYEELEKQLKEVFKERSTILRQLTKTSRELDGIKVNLQ
  SLKNDEQSAKTDVQKLLELGQKQREEMKSLQEALQNQLKETSEKAEKHQATINFLKTEVE
  RKSKMIRDLQNENKSLKNKLLSGNKLCGIHAEESKKIQAQLKELRYGKKDLLFKAQQLTD
  LEQKLAVAKNELEKAALDRESQMKAMKETVQLCLTSVFRDQPPPPLSLITSNPTRMLLPP
  RNIASKLPDAAAKSKPQQSASGNNESSQVESTKEGNPSTTACDSQDEGRPCSMKHKESPP
  SNATAETEPIPQKLQMPPCSECEVKKAPEKPLTSFEGMAAREEKIL

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[1]
Neoplasm	DISZKGEW	Strong	Altered Expression	[2]
Childhood kidney Wilms tumor	DIS0NMK3	Limited	Biomarker	[3]
Wilms tumor	DISB6T16	Limited	Biomarker	[3]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Daunorubicin	DMQUSBT	Approved	Leucine zipper protein 2 (LUZP2) affects the response to substance of Daunorubicin.	[6]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Leucine zipper protein 2 (LUZP2).	[4]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Leucine zipper protein 2 (LUZP2).	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Leucine zipper protein 2 (LUZP2).	[5]

References

• [1] Genome-wide association study identifies two loci influencing plasma neurofilament light levels.BMC Med Genomics. 2018 May 10;11(1):47. doi: 10.1186/s12920-018-0364-8.
• [2] Alterations of androgen receptor-regulated enhancer RNAs (eRNAs) contribute to enzalutamide resistance in castration-resistant prostate cancer.Oncotarget. 2016 Jun 21;7(25):38551-38565. doi: 10.18632/oncotarget.9535.
• [3] Cloning, functional study and comparative mapping of Luzp2 to mouse chromosome 7 and human chromosome 11p13-11p14.Mamm Genome. 2003 May;14(5):323-34. doi: 10.1007/s00335-002-2248-6.
• [4] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] Mapping genes that contribute to daunorubicin-induced cytotoxicity. Cancer Res. 2007 Jun 1;67(11):5425-33. doi: 10.1158/0008-5472.CAN-06-4431.