Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGGSJW3)

• DOT Name: POTE ankyrin domain family member G (POTEG)
• Synonyms: ANKRD26-like family C member 2; Prostate, ovary, testis-expressed protein on chromosome 14; POTE-14
• Gene Name: POTEG
• Related Disease:
  Carcinoma of esophagus
  Esophageal cancer
  Esophageal squamous cell carcinoma
  Neoplasm
  Neoplasm of esophagus
• UniProt ID: POTEG_HUMAN
• Pfam ID: PF12796
• Sequence:
  MVAEAGSMPAASSVKKPFGLRSKMGKWCRHCFPWCRGSGKSNVGTSGDHDDSAMKTLRSK
  MGKWCRHCFPWCRGSSKSNVGTSGDHDDSAMKTLRSKMGKWCCHCFPCCRGSGKSKVGPW
  GDYDDSAFMEPRYHVRREDLDKLHRAAWWGKVPRKDLIVMLKDTDMNKKDKQKRTALHLA
  SANGNSEVVKLLLDRRCQLNILDNKKRTALTKAVQCREDECALMLLEHGTDPNIPDEYGN
  TALHYAIYNEDKLMAKALLLYGADIESKNKHGLTPLLLGVHEQKQQVVKFLIKKKANLNA
  LDRYGRTALILAVCCGSASIVSLLLEQNIDVSSQDLSGQTAREYAVSSHHNVICQLLSDY
  KEKQMLKVSSENSNPEQDLKLTSEEESQRLKGSENSQPEEMSQEPEINKGGDRKVEEEMK
  KHGSTHMGFPENLPNGATADNGDDGLIPPRKSRTPESQQFPDTENEQYHSDEQNDTQKQL
  SEEQNTGILQDEILIHEEKQIEVAENEF

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Carcinoma of esophagus	DISS6G4D	Strong	Biomarker	[1]
Esophageal cancer	DISGB2VN	Strong	Biomarker	[1]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[1]
Neoplasm	DISZKGEW	Strong	Altered Expression	[1]
Neoplasm of esophagus	DISOLKAQ	Strong	Biomarker	[1]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of POTE ankyrin domain family member G (POTEG).	[2]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of POTE ankyrin domain family member G (POTEG).	[3]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of POTE ankyrin domain family member G (POTEG).	[3]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of POTE ankyrin domain family member G (POTEG).	[4]

References

• [1] Down-regulation of POTEG predicts poor prognosis in esophageal squamous cell carcinoma patients.Mol Carcinog. 2018 Jul;57(7):886-895. doi: 10.1002/mc.22809. Epub 2018 Apr 6.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [4] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.