Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGJWBIF)

DOT Name	Kallikrein-9 (KLK9)
Synonyms	EC 3.4.21.-; Kallikrein-like protein 3; KLK-L3
Gene Name	KLK9
Related Disease	Breast cancer ( ) Breast carcinoma ( ) Epithelial ovarian cancer ( ) High blood pressure ( ) Neoplasm ( ) Ovarian cancer ( ) Ovarian neoplasm ( ) Systemic lupus erythematosus ( ) Squamous cell carcinoma ( )
UniProt ID	KLK9_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	3.4.21.-
Pfam ID	PF00089
Sequence	MKLGLLCALLSLLAGHGWADTRAIGAEECRPNSQPWQAGLFHLTRLFCGATLISDRWLLT AAHCRKPYLWVRLGEHHLWKWEGPEQLFRVTDFFPHPGFNKDLSANDHNDDIMLIRLPRQ ARLSPAVQPLNLSQTCVSPGMQCLISGWGAVSSPKALFPVTLQCANISILENKLCHWAYP GHISDSMLCAGLWEGGRGSCQGDSGGPLVCNGTLAGVVSGGAEPCSRPRRPAVYTSVCHY LDWIQEIMEN
Tissue Specificity	Skin, thymus, trachea, cerebellum and spinal cord.

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Breast cancer	DIS7DPX1	Strong	Biomarker	[1]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[1]
Epithelial ovarian cancer	DIS56MH2	Strong	Altered Expression	[2]
High blood pressure	DISY2OHH	Strong	Biomarker	[3]
Neoplasm	DISZKGEW	Strong	Altered Expression	[2]
Ovarian cancer	DISZJHAP	Strong	Altered Expression	[2]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[2]
Systemic lupus erythematosus	DISI1SZ7	Strong	Biomarker	[3]
Squamous cell carcinoma	DISQVIFL	Limited	Biomarker	[4]
------------------------------------------------------------------------------------


⏷ Show the Full List of 9 Disease(s)

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Kallikrein-9 (KLK9) affects the response to substance of Cisplatin.	[7]
------------------------------------------------------------------------------------

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Kallikrein-9 (KLK9).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Kallikrein-9 (KLK9).	[6]
------------------------------------------------------------------------------------

References

1	The prognostic value of the human kallikrein gene 9 (KLK9) in breast cancer.Breast Cancer Res Treat. 2003 Mar;78(2):149-58. doi: 10.1023/a:1022931403825.
2	Clinical relevance of kallikrein-related peptidase 9, 10, 11, and 15 mRNA expression in advanced high-grade serous ovarian cancer.PLoS One. 2017 Nov 2;12(11):e0186847. doi: 10.1371/journal.pone.0186847. eCollection 2017.
3	MiRNA and mRNA Profiling in Systemic Lupus Reveals a Novel Set of Cytokine - Related miRNAs and their Target Genes in Cases With and Without Renal Involvement.Kidney Blood Press Res. 2017;42(6):1322-1337. doi: 10.1159/000485987. Epub 2017 Dec 15.
4	Biochemical and functional characterization of the human tissue kallikrein 9.Biochem J. 2017 Jul 6;474(14):2417-2433. doi: 10.1042/BCJ20170174.
5	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
6	DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
7	Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.