Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGLTTKU)

DOT Name Disintegrin and metalloproteinase domain-containing protein 29 (ADAM29)
Synonyms ADAM 29; Cancer/testis antigen 73; CT73
Gene Name ADAM29
Related Disease
Breast cancer ( )
Breast carcinoma ( )
Estrogen-receptor positive breast cancer ( )
Obstructive sleep apnea ( )
Small lymphocytic lymphoma ( )
Gastric cancer ( )
Neoplasm ( )
Stomach cancer ( )
Venous thromboembolism ( )
UniProt ID
ADA29_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF08516 ; PF00200 ; PF01562 ; PF01421
Sequence
MKMLLLLHCLGVFLSCSGHIQDEHPQYHSPPDVVIPVRITGTTRGMTPPGWLSYILPFGG
QKHIIHIKVKKLLFSKHLPVFTYTDQGAILEDQPFVQNNCYYHGYVEGDPESLVSLSTCF
GGFQGILQINDFAYEIKPLAFSTTFEHLVYKMDSEEKQFSTMRSGFMQNEITCRMEFEEI
DNSTQKQSSYVGWWIHFRIVEIVVVIDNYLYIRYERNDSKLLEDLYVIVNIVDSILDVIG
VKVLLFGLEIWTNKNLIVVDDVRKSVHLYCKWKSENITPRMQHDTSHLFTTLGLRGLSGI
GAFRGMCTPHRSCAIVTFMNKTLGTFSIAVAHHLGHNLGMNHDEDTCRCSQPRCIMHEGN
PPITKFSNCSYGDFWEYTVERTKCLLETVHTKDIFNVKRCGNGVVEEGEECDCGPLKHCA
KDPCCLSNCTLTDGSTCAFGLCCKDCKFLPSGKVCRKEVNECDLPEWCNGTSHKCPDDFY
VEDGIPCKERGYCYEKSCHDRNEQCRRIFGAGANTASETCYKELNTLGDRVGHCGIKNAT
YIKCNISDVQCGRIQCENVTEIPNMSDHTTVHWARFNDIMCWSTDYHLGMKGPDIGEVKD
GTECGIDHICIHRHCVHITILNSNCSPAFCNKRGICNNKHHCHCNYLWDPPNCLIKGYGG
SVDSGPPPKRKKKKKFCYLCILLLIVLFILLCCLYRLCKKSKPIKKQQDVQTPSAKEEEK
IQRRPHELPPQSQPWVMPSQSQPPVTPSQSHPQVMPSQSQPPVTPSQSQPRVMPSQSQPP
VMPSQSHPQLTPSQSQPPVTPSQRQPQLMPSQSQPPVTPS
Function May be involved in spermatogenesis and fertilization. Seems to be a non catalytic metalloprotease-like protein.
Tissue Specificity Expressed specifically in testes.

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Breast cancer DIS7DPX1 Strong Biomarker [1]
Breast carcinoma DIS2UE88 Strong Genetic Variation [2]
Estrogen-receptor positive breast cancer DIS1H502 Strong Genetic Variation [3]
Obstructive sleep apnea DIS0SVD1 Strong Altered Expression [4]
Small lymphocytic lymphoma DIS30POX Strong Altered Expression [5]
Gastric cancer DISXGOUK moderate Altered Expression [6]
Neoplasm DISZKGEW moderate Altered Expression [6]
Stomach cancer DISKIJSX moderate Altered Expression [6]
Venous thromboembolism DISUR7CR moderate Genetic Variation [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Disintegrin and metalloproteinase domain-containing protein 29 (ADAM29). [8]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Disintegrin and metalloproteinase domain-containing protein 29 (ADAM29). [10]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Disintegrin and metalloproteinase domain-containing protein 29 (ADAM29). [9]
------------------------------------------------------------------------------------

References

1 ADAM29 Expression in Human Breast Cancer and its Effects on Breast Cancer Cells In Vitro.Anticancer Res. 2016 Mar;36(3):1251-8.
2 Association analysis identifies 65 new breast cancer risk loci.Nature. 2017 Nov 2;551(7678):92-94. doi: 10.1038/nature24284. Epub 2017 Oct 23.
3 Association study of susceptibility loci with specific breast cancer subtypes in Chinese women.Breast Cancer Res Treat. 2014 Aug;146(3):503-14. doi: 10.1007/s10549-014-3041-4. Epub 2014 Jul 10.
4 Gene expression profiles in peripheral blood mononuclear cells of Asian obstructive sleep apnea patients.Biomed J. 2014 Mar-Apr;37(2):60-70. doi: 10.4103/2319-4170.113188.
5 IGHV gene mutational status and LPL/ADAM29 gene expression as clinical outcome predictors in CLL patients in remission following treatment with oral fludarabine plus cyclophosphamide.Ann Hematol. 2009 Dec;88(12):1215-21. doi: 10.1007/s00277-009-0742-6. Epub 2009 Apr 2.
6 Clinical significance of ADAM29 promoting the invasion and growth of gastric cancer cells in vitro.Oncol Lett. 2018 Aug;16(2):1483-1490. doi: 10.3892/ol.2018.8838. Epub 2018 May 30.
7 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.BMC Med Genet. 2013 Mar 20;14:36. doi: 10.1186/1471-2350-14-36.
8 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
9 Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
10 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.