Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGZATAC)

• DOT Name: Histo-blood group ABO system transferase (ABO)
• Synonyms: Fucosylglycoprotein 3-alpha-galactosyltransferase; Fucosylglycoprotein alpha-N-acetylgalactosaminyltransferase; Glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase; EC 2.4.1.40; Glycoprotein-fucosylgalactoside alpha-galactosyltransferase; EC 2.4.1.37; Histo-blood group A transferase; A transferase; Histo-blood group B transferase; B transferase; NAGAT
• Gene Name: ABO
• UniProt ID: BGAT_HUMAN
• PDB ID: 1LZ0 ; 1LZ7 ; 1LZI ; 1LZJ ; 1R7T ; 1R7U ; 1R7V ; 1R7X ; 1R7Y ; 1R80 ; 1R81 ; 1R82 ; 1WSZ ; 1WT0 ; 1WT1 ; 1WT2 ; 1WT3 ; 1XZ6 ; 1ZHJ ; 1ZI1 ; 1ZI3 ; 1ZI4 ; 1ZI5 ; 1ZIZ ; 1ZJ0 ; 1ZJ1 ; 1ZJ2 ; 1ZJ3 ; 1ZJO ; 1ZJP ; 2A8U ; 2A8W ; 2I7B ; 2O1F ; 2O1G ; 2O1H ; 2PGV ; 2PGY ; 2RIT ; 2RIX ; 2RIY ; 2RIZ ; 2RJ0 ; 2RJ1 ; 2RJ4 ; 2RJ5 ; 2RJ6 ; 2RJ7 ; 2RJ8 ; 2RJ9 ; 2Y7A ; 3I0C ; 3I0D ; 3I0E ; 3I0F ; 3I0G ; 3I0H ; 3I0I ; 3I0J ; 3I0K ; 3I0L ; 3IOH ; 3IOI ; 3IOJ ; 3SX3 ; 3SX5 ; 3SX7 ; 3SX8 ; 3SXA ; 3SXB ; 3SXC ; 3SXD ; 3SXE ; 3SXG ; 3U0X ; 3U0Y ; 3V0L ; 3V0M ; 3V0N ; 3V0O ; 3V0P ; 3V0Q ; 3ZGF ; 3ZGG ; 4C2S ; 4FQW ; 4FRA ; 4FRB ; 4FRD ; 4FRE ; 4FRH ; 4FRL ; 4FRM ; 4FRO ; 4FRP ; 4FRQ ; 4GBP ; 4KC1 ; 4KC2 ; 4KC4 ; 4KXO ; 4Y62 ; 4Y63 ; 4Y64 ; 5BXC ; 5C1G ; 5C1H ; 5C1L ; 5C36 ; 5C38 ; 5C3A ; 5C3B ; 5C3D ; 5C47 ; 5C48 ; 5C49 ; 5C4B ; 5C4C ; 5C4D ; 5C4E ; 5C4F ; 5C8R ; 5CMF ; 5CMG ; 5CMH ; 5CMI ; 5CMJ ; 5CQL ; 5CQM ; 5CQN ; 5CQO ; 5CQP ; 5M79 ; 5M7A ; 5M7B ; 5M7C ; 5M7D ; 5TJK ; 5TJL ; 5TJN ; 5TJO ; 6BJI ; 6BJJ ; 6BJK ; 6BJL ; 6BJM ; 6GWY ; 6GWZ ; 6GX0 ; 6GX1 ; 6GX2
• EC Number: 2.4.1.37; 2.4.1.40
• Pfam ID: PF03414
• Sequence:
  MAEVLRTLAGKPKCHALRPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVREPDH
  LQRVSLPRMVYPQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTV
  FAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVRAYKR
  WQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPGFYGSS
  REAFTYERRPQSQAYIPKDEGDFYYLGGFFGGSVQEVQRLTRACHQAMMVDQANGIEAVW
  HDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPAVLRKLRFTAVPKNHQAVRNP
• Function: This protein is the basis of the ABO blood group system. The histo-blood group ABO involves three carbohydrate antigens: A, B, and H. A, B, and AB individuals express a glycosyltransferase activity that converts the H antigen to the A antigen (by addition of UDP-GalNAc) or to the B antigen (by addition of UDP-Gal), whereas O individuals lack such activity.
• KEGG Pathway:
  Glycosphingolipid biosynthesis - lacto and neolacto series (hsa00601)
  Glycosphingolipid biosynthesis - globo and isoglobo series (hsa00603)
  Metabolic pathways (hsa01100)
• Reactome Pathway: ABO blood group biosynthesis (R-HSA-9033807)
• BioCyc Pathway: MetaCyc:HS10887-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Histo-blood group ABO system transferase (ABO).	[1]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Histo-blood group ABO system transferase (ABO).	[3]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Histo-blood group ABO system transferase (ABO).	[4]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Histo-blood group ABO system transferase (ABO).	[2]

References

• [1] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [2] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [3] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [4] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.