Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTH1OGZW)

DOT Name SLAM family member 9 (SLAMF9)
Synonyms CD2 family member 10; CD2F-10; CD84 homolog 1; CD84-H1
Gene Name SLAMF9
Related Disease
Hepatitis ( )
Melanocytic nevus ( )
Melanoma ( )
Nervous system inflammation ( )
UniProt ID
SLAF9_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MCAFPWLLLLLLLQEGSQRRLWRWCGSEEVVAVLQESISLPLEIPPDEEVENIIWSSHKS
LATVVPGKEGHPATIMVTNPHYQGQVSFLDPSYSLHISNLSWEDSGLYQAQVNLRTSQIS
TMQQYNICVYRWLSEPQITVNFESSGEGACSMSLVCSVEKAGMDMTYSWLSRGDSTYTFH
EGPVLSTSWRPGDSALSYTCRANNPISNVSSCPIPDGPFYADPNYASEKPSTAFCLLAKG
LLIFLLLVILAMGLWVIRVQKRHKMPRMKKLMRNRMKLRKEAKPGSSPA
Function May play a role in the immune response.
Tissue Specificity
Expression is predominantly restricted in hematopoietic tissues. Expressed in heart, spleen, liver, intestine, muscle and testis. Expressed in immune cells, including monocytes, dendritic, B- and T-cells. No expression was seen in peripheral blood leukocytes. Expressed in the leukocyte cell line THP-1.

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Hepatitis DISXXX35 Disputed Biomarker [1]
Melanocytic nevus DISYS32D Disputed Altered Expression [2]
Melanoma DIS1RRCY Disputed Altered Expression [2]
Nervous system inflammation DISB3X5A Limited Biomarker [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of SLAM family member 9 (SLAMF9). [4]
------------------------------------------------------------------------------------

References

1 Combined deficiency of SLAMF8 and SLAMF9 prevents endotoxin-induced liver inflammation by downregulating TLR4 expression on macrophages.Cell Mol Immunol. 2020 Feb;17(2):153-162. doi: 10.1038/s41423-018-0191-z. Epub 2018 Dec 14.
2 The novel immunoglobulin super family receptor SLAMF9 identified in TAM of murine and human melanoma influences pro-inflammatory cytokine secretion and migration.Cell Death Dis. 2018 Sep 19;9(10):939. doi: 10.1038/s41419-018-1011-1.
3 SLAMF9 regulates pDC homeostasis and function in health and disease.Proc Natl Acad Sci U S A. 2019 Aug 13;116(33):16489-16496. doi: 10.1073/pnas.1900079116. Epub 2019 Jul 25.
4 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.