Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHBAGUE)

• DOT Name: MORN repeat-containing protein 4 (MORN4)
• Synonyms: Protein 44050; Retinophilin
• Gene Name: MORN4
• Related Disease:
  Hepatitis B virus infection
  Prostate neoplasm
• UniProt ID: MORN4_HUMAN
• Pfam ID: PF02493
• Sequence:
  MTLTKGSFTYSSGEEYRGEWKEGRRHGFGQLMFADGGTYLGHFENGLFNGFGVLTFSDGS
  RYEGEFAQGKFNGVGVFIRYDNMTFEGEFKNGRVDGFGLLTFPDGSHGIPRNEGLFENNK
  LLRREKCSAIVQRAQSASKSARNLTA
• Function: Plays a role in promoting axonal degeneration following neuronal injury by toxic insult or trauma.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hepatitis B virus infection	DISLQ2XY	Strong	Genetic Variation	[1]
Prostate neoplasm	DISHDKGQ	Strong	Altered Expression	[2]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of MORN repeat-containing protein 4 (MORN4).	[3]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of MORN repeat-containing protein 4 (MORN4).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of MORN repeat-containing protein 4 (MORN4).	[5]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of MORN repeat-containing protein 4 (MORN4).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of MORN repeat-containing protein 4 (MORN4).	[7]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of MORN repeat-containing protein 4 (MORN4).	[8]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of MORN repeat-containing protein 4 (MORN4).	[9]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of MORN repeat-containing protein 4 (MORN4).	[10]

References

• [1] A comparison of molecular methods for hepatitis B virus (HBV) DNA detection from oral fluid samples.J Med Microbiol. 2012 Jun;61(Pt 6):844-851. doi: 10.1099/jmm.0.040238-0. Epub 2012 Mar 8.
• [2] The differentiation-related gene 1, Drg1, is markedly upregulated by androgens in LNCaP prostatic adenocarcinoma cells.FEBS Lett. 1999 Jul 16;455(1-2):23-6. doi: 10.1016/s0014-5793(99)00845-5.
• [3] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [4] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [5] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [6] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [7] Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
• [8] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [9] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [10] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.