Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHH2EFT)

• DOT Name: GTPase IMAP family member 2 (GIMAP2)
• Synonyms: Immunity-associated protein 2; hIMAP2
• Gene Name: GIMAP2
• UniProt ID: GIMA2_HUMAN
• PDB ID: 2XTM; 2XTN; 2XTO; 2XTP; 3P1J
• Pfam ID: PF04548
• Sequence:
  MDQNEHSHWGPHAKGQCASRSELRIILVGKTGTGKSAAGNSILRKQAFESKLGSQTLTKT
  CSKSQGSWGNREIVIIDTPDMFSWKDHCEALYKEVQRCYLLSAPGPHVLLLVTQLGRYTS
  QDQQAAQRVKEIFGEDAMGHTIVLFTHKEDLNGGSLMDYMHDSDNKALSKLVAACGGRIC
  AFNNRAEGSNQDDQVKELMDCIEDLLMEKNGDHYTNGLYSLIQRSKCGPVGSDERVKEFK
  QSLIKYMETQRSYTALAEANCLKGALIKTQLCVLFCIQLFLRLIILWLCILHSMCNLFCC
  LLFSMCNLFCSLLFIIPKKLMIFLRTVIRLERKTPRL
• Function: The heterodimer formed by GIMAP2 and GIMAP7 has GTPase activity. In contrast, GIMAP2 has no GTPase activity by itself.
• Tissue Specificity: Detected in T-cells.

Molecular Interaction Atlas (MIA) of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of GTPase IMAP family member 2 (GIMAP2).	[1]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of GTPase IMAP family member 2 (GIMAP2).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of GTPase IMAP family member 2 (GIMAP2).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of GTPase IMAP family member 2 (GIMAP2).	[4]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of GTPase IMAP family member 2 (GIMAP2).	[5]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of GTPase IMAP family member 2 (GIMAP2).	[6]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [4] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [5] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [6] Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.