Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIFETOM)

• DOT Name: Cancer/testis antigen family 45 member A6 (CT45A5)
• Synonyms: Cancer/testis antigen 45-6; Cancer/testis antigen 45A6
• Gene Name: CT45A5
• UniProt ID: CT456_HUMAN
• Pfam ID: PF15300
• Sequence:
  MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMT
  GHAIPPSQLDSQIDDFTGFSKDGMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQR
  EINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKH
  LKKKLKRMI
• Tissue Specificity: Testis specific. Expressed in cancer cell lines.

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Cancer/testis antigen family 45 member A6 (CT45A5).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Cancer/testis antigen family 45 member A6 (CT45A5).	[5]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Cancer/testis antigen family 45 member A6 (CT45A5).	[2]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Cancer/testis antigen family 45 member A6 (CT45A5).	[3]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of Cancer/testis antigen family 45 member A6 (CT45A5).	[4]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Cancer/testis antigen family 45 member A6 (CT45A5).	[6]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [4] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [5] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [6] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.