Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIL2CC7)

DOT Name Transmembrane protein 35B (TMEM35B)
Synonyms ZMYM6 neighbor protein
Gene Name TMEM35B
UniProt ID
TM35B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF07681
Sequence
MALLLSVLRVLLGGFFALVGLAKLSEEISAPVSERMNALFVQFAEVFPLKVFGYQPDPLN
YQIAVGFLELLAGLLLVMGPPMLQEISNLFLILLMMGAIFTLAALKESLSTCIPAIVCLG
FLLLLNVGQLLAQTKKVVRPTRKKTLSTFKESWK

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Transmembrane protein 35B (TMEM35B). [1]
Cisplatin DMRHGI9 Approved Cisplatin affects the expression of Transmembrane protein 35B (TMEM35B). [2]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Transmembrane protein 35B (TMEM35B). [2]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Transmembrane protein 35B (TMEM35B). [3]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Transmembrane protein 35B (TMEM35B). [1]
------------------------------------------------------------------------------------

References

1 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
2 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
3 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.