Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTILBHCE)

• DOT Name: Serpin B13 (SERPINB13)
• Synonyms: HaCaT UV-repressible serpin; Hurpin; Headpin; Peptidase inhibitor 13; PI-13; Proteinase inhibitor 13
• Gene Name: SERPINB13
• Related Disease:
  Head-neck squamous cell carcinoma
  Neoplasm
  Squamous cell carcinoma
• UniProt ID: SPB13_HUMAN
• Pfam ID: PF00079
• Sequence:
  MDSLGAVSTRLGFDLFKELKKTNDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSE
  KETKSSRIKAEEKEVIENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKY
  LDYVEKYYHASLEPVDFVNAADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNM
  VYFKGQWDREFKKENTKEEKFWMNKSTSKSVQMMTQSHSFSFTFLEDLQAKILGIPYKNN
  DLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERKVNLHLPRFEVEDGYDLEAVL
  AAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATGIGFTVTSAPG
  HENVHCNHPFLFFIRHNESNSILFFGRFSSP
• Function: May play a role in the proliferation or differentiation of keratinocytes.
• Tissue Specificity: Skin specific.
• KEGG Pathway: Amoebiasis (hsa05146)
• Reactome Pathway: RUNX1 regulates transcription of genes involved in differentiation of keratinocytes (R-HSA-8939242)

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Head-neck squamous cell carcinoma	DISF7P24	Strong	Altered Expression	[1]
Neoplasm	DISZKGEW	Strong	Biomarker	[1]
Squamous cell carcinoma	DISQVIFL	Strong	Altered Expression	[1]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Serpin B13 (SERPINB13).	[2]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Serpin B13 (SERPINB13).	[6]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
DNCB	DMDTVYC	Phase 2	DNCB affects the binding of Serpin B13 (SERPINB13).	[3]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Serpin B13 (SERPINB13).	[4]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Serpin B13 (SERPINB13).	[5]

References

• [1] Downregulation of SERPINB13 expression in head and neck squamous cell carcinomas associates with poor clinical outcome.Int J Cancer. 2009 Oct 1;125(7):1542-50. doi: 10.1002/ijc.24507.
• [2] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [3] Proteomic analysis of the cellular response to a potent sensitiser unveils the dynamics of haptenation in living cells. Toxicology. 2020 Dec 1;445:152603. doi: 10.1016/j.tox.2020.152603. Epub 2020 Sep 28.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [6] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.