Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIQJS2P)

DOT Name	SAYSvFN domain-containing protein 1 (SAYSD1)
Gene Name	SAYSD1
UniProt ID	SMDC1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF10260
Sequence	MEQRLAEFRAARKRAGLAAQPPAASQGAQTPGEKAEAAATLKAAPGWLKRFLVWKPRPAS ARAQPGLVQEAAQPQGSTSETPWNTAIPLPSCWDQSFLTNITFLKVLLWLVLLGLFVELE FGLAYFVLSLFYWMYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLERELQLRPL AGR

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of SAYSvFN domain-containing protein 1 (SAYSD1).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of SAYSvFN domain-containing protein 1 (SAYSD1).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of SAYSvFN domain-containing protein 1 (SAYSD1).	[3]
------------------------------------------------------------------------------------

References

1	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
2	Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
3	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.