Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIUTWBD)

• DOT Name: BarH-like 1 homeobox protein (BARHL1)
• Gene Name: BARHL1
• Related Disease:
  Alzheimer disease
  Breast cancer
  Joubert syndrome
  Medulloblastoma
• UniProt ID: BARH1_HUMAN
• Pfam ID: PF00046
• Sequence:
  MEGSNGFGIDSILSHRAGSPALPKGDPLLGDCRSPLELSPRSESSSDCSSPASPGRDCLE
  TGTPRPGGASGPGLDSHLQPGQLSAPAQSRTVTSSFLIRDILADCKPLAACAPYSSSGQP
  AAPEPGGRLAAKAAEDFRDKLDKSGSNASSDSEYKVKEEGDREISSSRDSPPVRLKKPRK
  ARTAFTDHQLAQLERSFERQKYLSVQDRMELAASLNLTDTQVKTWYQNRRTKWKRQTAVG
  LELLAEAGNYSALQRMFPSPYFYPQSLVSNLDPGAALYLYRGPSAPPPALQRPLVPRILI
  HGLQGASEPPPPLPPLAGVLPRAAQPR

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Alzheimer disease	DISF8S70	Strong	Biomarker	[1]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[1]
Joubert syndrome	DIS7P5CO	Strong	Biomarker	[2]
Medulloblastoma	DISZD2ZL	Strong	Altered Expression	[1]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of BarH-like 1 homeobox protein (BARHL1).	[3]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of BarH-like 1 homeobox protein (BARHL1).	[5]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of BarH-like 1 homeobox protein (BARHL1).	[4]

References

• [1] BARHL1 Is Downregulated in Alzheimer's Disease and May Regulate Cognitive Functions through ESR1 and Multiple Pathways.Genes (Basel). 2017 Sep 28;8(10):245. doi: 10.3390/genes8100245.
• [2] Search for genes involved in Joubert syndrome: evidence that one or more major loci are yet to be identified and exclusion of candidate genes EN1, EN2, FGF8, and BARHL1.Am J Med Genet. 2002 Jan 22;107(3):190-6.
• [3] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [4] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [5] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.