Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIWCL05)

• DOT Name: Tetraspanin-16 (TSPAN16)
• Synonyms: Tspan-16; Tetraspanin TM4-B; Transmembrane 4 superfamily member 16
• Gene Name: TSPAN16
• Related Disease:
  Acute lymphocytic leukaemia
  Alzheimer disease
  Breast carcinoma
  Childhood acute lymphoblastic leukemia
• UniProt ID: TSN16_HUMAN
• Pfam ID: PF00335
• Sequence:
  MAEIHTPYSSLKKLLSLLNGFVAVSGIILVGLGIGGKCGGASLTNVLGLSSAYLLHVGNL
  CLVMGCITVLLGCAGWYGATKESRGTLLFCILSMVIVLIMEVTAATVVLLFFPIVGDVAL
  EHTFVTLRKNYRGYNEPDDYSTQWNLVMEKLKCCGVNNYTDFSGSSFEMTTGHTYPRSCC
  KSIGSVSCDGRDVSPNVIHQKGCFHKLLKITKTQSFTLSGSSLGAAVIQRWGSRYVAQAG
  LELLA
• Tissue Specificity: Broadly expressed in most human tissues and cell lines including neural and bone marrow derived tissues.

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute lymphocytic leukaemia	DISPX75S	Strong	Biomarker	[1]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[2]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[3]
Childhood acute lymphoblastic leukemia	DISJ5D6U	Strong	Biomarker	[1]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Tetraspanin-16 (TSPAN16).	[4]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the mutagenesis of Tetraspanin-16 (TSPAN16).	[5]

References

• [1] Differential gene expression patterns and interaction networks in BCR-ABL-positive and -negative adult acute lymphoblastic leukemias.J Clin Oncol. 2007 Apr 10;25(11):1341-9. doi: 10.1200/JCO.2006.09.3534. Epub 2007 Feb 20.
• [2] Family-based association analyses of imputed genotypes reveal genome-wide significant association of Alzheimer's disease with OSBPL6, PTPRG, and PDCL3.Mol Psychiatry. 2016 Nov;21(11):1608-1612. doi: 10.1038/mp.2015.218. Epub 2016 Feb 2.
• [3] Identification of ten variants associated with risk of estrogen-receptor-negative breast cancer.Nat Genet. 2017 Dec;49(12):1767-1778. doi: 10.1038/ng.3785. Epub 2017 Oct 23.
• [4] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [5] Exome-wide mutation profile in benzo[a]pyrene-derived post-stasis and immortal human mammary epithelial cells. Mutat Res Genet Toxicol Environ Mutagen. 2014 Dec;775-776:48-54. doi: 10.1016/j.mrgentox.2014.10.011. Epub 2014 Nov 4.