Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIX56CJ)

• DOT Name: Carbonic anhydrase 6 (CA6)
• Synonyms: EC 4.2.1.1; Carbonate dehydratase VI; Carbonic anhydrase VI; CA-VI; Salivary carbonic anhydrase; Secreted carbonic anhydrase
• Gene Name: CA6
• UniProt ID: CAH6_HUMAN
• PDB ID: 3FE4
• EC Number: 4.2.1.1
• Pfam ID: PF00194
• Sequence:
  MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYN
  PSLKGLNMTGYETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSE
  ISGSEHTVDGIRHVIEIHIVHYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNF
  ISHLANIKYPGQRTTLTGLDVQDMLPRNLQHYYTYHGSLTTPPCTENVHWFVLADFVKLS
  RTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPNQEYTLGSEFQFYLHKIEEIL
  DYLRRALN
• Function: Reversible hydration of carbon dioxide. Its role in saliva is unknown.
• Tissue Specificity: Major constituent of saliva.
• KEGG Pathway:
  Nitrogen metabolism (hsa00910)
  Metabolic pathways (hsa01100)
• Reactome Pathway: Reversible hydration of carbon dioxide (R-HSA-1475029)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Propylthiouracil	DM6D7N8	Approved	Carbonic anhydrase 6 (CA6) affects the response to substance of Propylthiouracil.	[5]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Carbonic anhydrase 6 (CA6).	[1]
Arsenic	DMTL2Y1	Approved	Arsenic affects the expression of Carbonic anhydrase 6 (CA6).	[2]
DTI-015	DMXZRW0	Approved	DTI-015 decreases the expression of Carbonic anhydrase 6 (CA6).	[3]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Carbonic anhydrase 6 (CA6).	[4]

References

• [1] Retinoic acid-induced downmodulation of telomerase activity in human cancer cells. Exp Mol Pathol. 2005 Oct;79(2):108-17.
• [2] Drinking-water arsenic exposure modulates gene expression in human lymphocytes from a U.S. population. Environ Health Perspect. 2008 Apr;116(4):524-31. doi: 10.1289/ehp.10861.
• [3] Gene expression profile induced by BCNU in human glioma cell lines with differential MGMT expression. J Neurooncol. 2005 Jul;73(3):189-98.
• [4] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [5] Responsiveness to 6-n-propylthiouracil (PROP) is associated with salivary levels of two specific basic proline-rich proteins in humans. PLoS One. 2012;7(2):e30962. doi: 10.1371/journal.pone.0030962. Epub 2012 Feb 1.