Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJ1J42N)

DOT Name	Transcription factor HES-3 (HES3)
Synonyms	Class B basic helix-loop-helix protein 43; bHLHb43; Hairy and enhancer of split 3
Gene Name	HES3
Related Disease	Advanced cancer ( ) Insulinoma ( ) Lung cancer ( ) Lung carcinoma ( ) Non-small-cell lung cancer ( ) Type-1/2 diabetes ( )
UniProt ID	HES3_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00010
Sequence	MEKKRRARINVSLEQLKSLLEKHYSHQIRKRKLEKADILELSVKYMRSLQNSLQGLWPVP RGAEQPSGFRSCLPGVSQLLRRGDEVGSGLRCPLVPESAAGSTMDSAGLGQEAPALFRPC TPAVWAPAPAAGGPRSPPPLLLLPESLPGSSASVPPPQPASSRCAESPGLGLRVWRPWGS PGDDLN
Function	Transcriptional repressor of genes that require a bHLH protein for their transcription.
KEGG Pathway	Human papillomavirus infection (hsa05165 )

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[1]
Insulinoma	DISIU1JS	Strong	Biomarker	[2]
Lung cancer	DISCM4YA	Strong	Biomarker	[1]
Lung carcinoma	DISTR26C	Strong	Biomarker	[1]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[1]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[3]
------------------------------------------------------------------------------------


⏷ Show the Full List of 6 Disease(s)

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Transcription factor HES-3 (HES3).	[4]
------------------------------------------------------------------------------------

References

1	Hes3 Enhances the Malignant Phenotype of Lung Cancer through Upregulating Cyclin D1, Cyclin D3 and MMP7 Expression.Int J Med Sci. 2019 Mar 9;16(3):470-476. doi: 10.7150/ijms.28139. eCollection 2019.
2	Hes3 is expressed in the adult pancreatic islet and regulates gene expression, cell growth, and insulin release.J Biol Chem. 2014 Dec 19;289(51):35503-16. doi: 10.1074/jbc.M114.590687. Epub 2014 Nov 4.
3	Streptozotocin-induced -cell damage, high fat diet, and metformin administration regulate Hes3 expression in the adult mouse brain.Sci Rep. 2018 Jul 27;8(1):11335. doi: 10.1038/s41598-018-29434-2.
4	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.