Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJ5H965)

• DOT Name: Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1)
• Gene Name: ITPRIPL1
• Related Disease: Lung adenocarcinoma
• UniProt ID: IPIL1_HUMAN
• Pfam ID: PF20266
• Sequence:
  MNVDAEASMAVISLLFLAVMYVVHHPLMVSDRMDLDTLARSRQLEKRMSEEMRLLEMEFE
  ERKRAAEQRQKAENFWTGDTSSDQLVLGKKDMGWPFQADGQEGPLGWMLGNLWNTGLFCL
  FLVFELLRQNMQHEPAFDSSSEEEEEEVRVVPVTSYNWLTDFPSQEALDSFYKHYVQNAI
  RDLPCTCEFVESFVDDLIEACRVLSRQEAHPQLEDCLGIGAAFEKWGTLHETQKFDILVP
  IVPPQGTMFVLEMRDPALGRRCGCVLVESECVCKREKLLGDVLCLVHHHRDPSAVLGKCS
  SSIKAALCTGFHLDVCKTVQWFRNMMGNAWALVAHKYDFKLSLPPSTTSCKLRLDYRSGR
  FLSIHLVLGVQREDTLVYLVSQAPDQEQLTSVDWPESFVACEHLFLKLVGRFAPENTCHL
  KCLQIILSLRQHQSLPHGASRPILTSYHFKTALMHLLLRLPLTDWAHNMLSQRLQDILWF
  LGRGLQQRSLHHFLIGNNFLPLTIPIPKTFRNAEPVNLFQHLVLNPKAHSQAVEEFQNLL
  TQVKTLPHAPLAAAP

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[1]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1).	[2]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1).	[3]
Demecolcine	DMCZQGK	Approved	Demecolcine decreases the expression of Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1).	[4]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1).	[5]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1).	[7]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1).	[8]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1).	[9]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 (ITPRIPL1).	[4]

References

• [1] Methylation and transcriptome analysis reveal lung adenocarcinoma-specific diagnostic biomarkers.J Transl Med. 2019 Sep 27;17(1):324. doi: 10.1186/s12967-019-2068-z.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [4] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [5] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [6] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [7] New insights into BaP-induced toxicity: role of major metabolites in transcriptomics and contribution to hepatocarcinogenesis. Arch Toxicol. 2016 Jun;90(6):1449-58.
• [8] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [9] Bisphenol A Exposure Changes the Transcriptomic and Proteomic Dynamics of Human Retinoblastoma Y79 Cells. Genes (Basel). 2021 Feb 11;12(2):264. doi: 10.3390/genes12020264.