Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJ9E3R7)

DOT Name	Keratin-associated protein 5-9 (KRTAP5-9)
Synonyms	Keratin, cuticle, ultrahigh sulfur 1; Keratin, ultra high-sulfur matrix protein A; Keratin-associated protein 5.9; UHS keratin A; UHS KerA; Ultrahigh sulfur keratin-associated protein 5.9
Gene Name	KRTAP5-9
Related Disease	Arthritis ( ) Rheumatoid arthritis ( )
UniProt ID	KRA59_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Sequence	MGCCGCSGGCGSSCGGCDSSCGSCGSGCRGCGPSCCAPVYCCKPVCCCVPACSCSSCGKR GCGSCGGSKGGCGSCGCSQCSCCKPCCCSSGCGSSCCQCSCCKPYCSQCSCCKPCCSSSG RGSSCCQSSCCKPCCSSSGCGSSCCQSSCCKPCCSQSRCCVPVCYQCKI
Function	In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated protein (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.
Tissue Specificity	Restricted to hair root, not detected in any other tissues. Expressed in cuticle layers of differentiating hair follicles.
Reactome Pathway	Keratinization (R-HSA-6805567 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Arthritis	DIST1YEL	Limited	Biomarker	[1]
Rheumatoid arthritis	DISTSB4J	Limited	Biomarker	[2]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

Jump to Detail Molecular Interaction Atlas of This DOT

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Keratin-associated protein 5-9 (KRTAP5-9).	[3]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Keratin-associated protein 5-9 (KRTAP5-9).	[4]
------------------------------------------------------------------------------------

References

1	Tumor necrosis factor receptor-associated factor 1 influences KRN/I-Ag7 mouse arthritis autoantibody production.J Clin Immunol. 2013 May;33(4):759-66. doi: 10.1007/s10875-013-9866-5. Epub 2013 Jan 26.
2	KRN/I-Ag7 mouse arthritis is independent of complement C3.J Clin Immunol. 2011 Oct;31(5):857-63. doi: 10.1007/s10875-011-9562-2. Epub 2011 Jul 6.
3	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
4	Comparison of transcriptome expression alterations by chronic exposure to low-dose bisphenol A in different subtypes of breast cancer cells. Toxicol Appl Pharmacol. 2019 Dec 15;385:114814. doi: 10.1016/j.taap.2019.114814. Epub 2019 Nov 9.