Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJBY7PV)

• DOT Name: OCIA domain-containing protein 1 (OCIAD1)
• Synonyms: Ovarian cancer immunoreactive antigen domain containing 1; Ovarian carcinoma immunoreactive antigen
• Gene Name: OCIAD1
• Related Disease:
  Estrogen-receptor positive breast cancer
  Ovarian neoplasm
  Advanced cancer
  Matthew-Wood syndrome
  Pancreatic cancer
  Pancreatic ductal carcinoma
• UniProt ID: OCAD1_HUMAN
• Pfam ID: PF07051
• Sequence:
  MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQG
  LISKGILSSHPKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQAR
  RSSPPGHYYQKSKYDSSVSGQSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHI
  VQGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPKKEVKVNKYG
  DTWDE
• Function: Maintains stem cell potency. Increases STAT3 phosphorylation and controls ERK phosphorylation. May act as a scaffold, increasing STAT3 recruitment onto endosomes. Involved in integrin-mediated cancer cell adhesion and colony formation in ovarian cancer.
• Tissue Specificity: Isoform 1 is highly expressed in many tissues, including testis, brain, placenta, ovary, prostate and mammary gland. Isoform 2 expression is restricted to the central nervous system including brain, cerebellum and spinal cord.

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Estrogen-receptor positive breast cancer	DIS1H502	Strong	Biomarker	[1]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[2]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[3]
Matthew-Wood syndrome	DISA7HR7	Limited	Altered Expression	[3]
Pancreatic cancer	DISJC981	Limited	Altered Expression	[3]
Pancreatic ductal carcinoma	DIS26F9Q	Limited	Biomarker	[3]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of OCIA domain-containing protein 1 (OCIAD1).	[4]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of OCIA domain-containing protein 1 (OCIAD1).	[10]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of OCIA domain-containing protein 1 (OCIAD1).	[11]

9 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of OCIA domain-containing protein 1 (OCIAD1).	[5]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of OCIA domain-containing protein 1 (OCIAD1).	[6]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of OCIA domain-containing protein 1 (OCIAD1).	[7]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of OCIA domain-containing protein 1 (OCIAD1).	[8]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of OCIA domain-containing protein 1 (OCIAD1).	[9]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of OCIA domain-containing protein 1 (OCIAD1).	[12]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of OCIA domain-containing protein 1 (OCIAD1).	[13]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of OCIA domain-containing protein 1 (OCIAD1).	[14]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of OCIA domain-containing protein 1 (OCIAD1).	[15]

References

• [1] Targeted MS Assay Predicting Tamoxifen Resistance in Estrogen-Receptor-Positive Breast Cancer Tissues and Sera.J Proteome Res. 2016 Apr 1;15(4):1230-42. doi: 10.1021/acs.jproteome.5b01119. Epub 2016 Mar 18.
• [2] Ovarian cancer immuno-reactive antigen domain containing 1 (OCIAD1), a key player in ovarian cancer cell adhesion.Gynecol Oncol. 2008 May;109(2):226-33. doi: 10.1016/j.ygyno.2007.12.024. Epub 2008 Mar 6.
• [3] OCIAD1 promoted pancreatic ductal adenocarcinoma migration by regulating ATM.Pancreatology. 2019 Jul;19(5):751-759. doi: 10.1016/j.pan.2019.01.009. Epub 2019 Jan 31.
• [4] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [7] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [8] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [9] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [12] Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
• [13] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [14] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [15] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.