Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJC3AB9)

DOT Name Bone morphogenetic protein 8B (BMP8B)
Synonyms BMP-8; BMP-8B; Osteogenic protein 2; OP-2
Gene Name BMP8B
Related Disease
Breast cancer ( )
Breast carcinoma ( )
Non-alcoholic fatty liver disease ( )
Pancreatic cancer ( )
Uterine fibroids ( )
Gastric cancer ( )
Neoplasm ( )
Stomach cancer ( )
UniProt ID
BMP8B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00019 ; PF00688
Sequence
MTALPGPLWLLGLALCALGGGGPGLRPPPGCPQRRLGARERRDVQREILAVLGLPGRPRP
RAPPAASRLPASAPLFMLDLYHAMAGDDDEDGAPAERRLGRADLVMSFVNMVERDRALGH
QEPHWKEFRFDLTQIPAGEAVTAAEFRIYKVPSIHLLNRTLHVSMFQVVQEQSNRESDLF
FLDLQTLRAGDEGWLVLDVTAASDCWLLKRHKDLGLRLYVETEDGHSVDPGLAGLLGQRA
PRSQQPFVVTFFRASPSPIRTPRAVRPLRRRQPKKSNELPQANRLPGIFDDVHGSHGRQV
CRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPD
AVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH
Function Induces cartilage and bone formation. May be the osteoinductive factor responsible for the phenomenon of epithelial osteogenesis. Plays a role in calcium regulation and bone homeostasis.
KEGG Pathway
Cytokine-cytokine receptor interaction (hsa04060 )
TGF-beta sig.ling pathway (hsa04350 )
Hippo sig.ling pathway (hsa04390 )
Thermogenesis (hsa04714 )

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Breast cancer DIS7DPX1 Strong Altered Expression [1]
Breast carcinoma DIS2UE88 Strong Altered Expression [1]
Non-alcoholic fatty liver disease DISDG1NL Strong Biomarker [2]
Pancreatic cancer DISJC981 Strong Biomarker [3]
Uterine fibroids DISBZRMJ Strong Genetic Variation [4]
Gastric cancer DISXGOUK moderate Altered Expression [5]
Neoplasm DISZKGEW moderate Biomarker [5]
Stomach cancer DISKIJSX moderate Altered Expression [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Bone morphogenetic protein 8B (BMP8B). [6]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Bone morphogenetic protein 8B (BMP8B). [7]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Bone morphogenetic protein 8B (BMP8B). [8]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Bone morphogenetic protein 8B (BMP8B). [7]
Paraoxon DMN4ZKC Investigative Paraoxon increases the expression of Bone morphogenetic protein 8B (BMP8B). [11]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Bone morphogenetic protein 8B (BMP8B). [9]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Bone morphogenetic protein 8B (BMP8B). [10]
------------------------------------------------------------------------------------

References

1 A comprehensive expression survey of bone morphogenetic proteins in breast cancer highlights the importance of BMP4 and BMP7.Breast Cancer Res Treat. 2007 Jun;103(2):239-46. doi: 10.1007/s10549-006-9362-1. Epub 2006 Sep 21.
2 Bone Morphogenetic Protein-8B Expression is Induced in Steatotic Hepatocytes and Promotes Hepatic Steatosis and Inflammation In Vitro.Cells. 2019 May 15;8(5):457. doi: 10.3390/cells8050457.
3 BMP8B mediates the survival of pancreatic cancer cells and regulates the progression of pancreatic cancer.Oncol Rep. 2014 Nov;32(5):1861-6. doi: 10.3892/or.2014.3413. Epub 2014 Aug 18.
4 Whole exome sequencing of benign pulmonary metastasizing leiomyoma reveals mutation in the BMP8B gene.BMC Med Genet. 2018 Jan 31;19(1):20. doi: 10.1186/s12881-018-0537-5.
5 BMP8B Is a Tumor Suppressor Gene Regulated by Histone Acetylation in Gastric Cancer.J Cell Biochem. 2017 Apr;118(4):869-877. doi: 10.1002/jcb.25766. Epub 2016 Nov 10.
6 The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
7 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
8 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
9 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
10 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
11 Genomic and phenotypic alterations of the neuronal-like cells derived from human embryonal carcinoma stem cells (NT2) caused by exposure to organophosphorus compounds paraoxon and mipafox. Int J Mol Sci. 2014 Jan 9;15(1):905-26. doi: 10.3390/ijms15010905.