Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJGTKK4)

• DOT Name: Protein INSYN2B (INSYN2B)
• Synonyms: Inhibitory synaptic factor family member 2B
• Gene Name: INSYN2B
• Related Disease:
  Lung adenocarcinoma
  Gastric cancer
  Stomach cancer
• UniProt ID: INY2B_HUMAN
• Pfam ID: PF15265
• Sequence:
  MAQQNMKVRPVLLKRNSLESVEFVKQPHHRRSKSQQVRFKEDGTTKNPTGLAEVDVQTPE
  DPAVMGKTQATRHHLPPTYSLSFPRSQKAGGFRNIAIQTSPSLRKHFPVFKRKRLTASKS
  LVEMPTASQSAIQVNGNLSEQDIVSSDLAYLRLAQHLEDGPRRVKVSHAFLPRVPKVQSN
  GPVSICLEAGTWRSLEKATAAIQVPDDIYHSPSWEARESALSPDRSAEVSNSIHPLDDTR
  PGDGRRVTPLDSEKSTSCLNATSVASHTPGTEELKPELLLPKDNSDDKDLGSLSSQSKET
  CVPSSPRTHSSPSQGSHSQPAHPGRASDCPSSSNNHQNLVSLKTNSASKSAPGCQEQTAN
  NPTESDTLEFPNCPGSNHLPSSLSRSETKLQSNREISDINQIHLARGELCDLQGRLQSVE
  ESLHSNQEKIKVLLNVIQDLEKARALTEGRNFYRTGQDLNNCSTCQNTACIIYSVEYDFR
  QQEGRFHEVLQSLEEAEPVEEASPPPKSPAEPPAPEKQDLRRKTKKVKKKCFWWI

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung adenocarcinoma	DISD51WR	Strong	Altered Expression	[1]
Gastric cancer	DISXGOUK	moderate	Biomarker	[2]
Stomach cancer	DISKIJSX	moderate	Biomarker	[2]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Protein INSYN2B (INSYN2B).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Protein INSYN2B (INSYN2B).	[4]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Protein INSYN2B (INSYN2B).	[5]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Protein INSYN2B (INSYN2B).	[7]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Protein INSYN2B (INSYN2B).	[8]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Protein INSYN2B (INSYN2B).	[9]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Protein INSYN2B (INSYN2B).	[6]

References

• [1] Effect of FAM196B in human lung adenocarcinoma.J Cancer. 2018 Jun 14;9(14):2451-2459. doi: 10.7150/jca.24907. eCollection 2018.
• [2] FAM196B acts as oncogene and promotes proliferation of gastric cancer cells through AKT signaling pathway.Cell Mol Biol (Noisy-le-grand). 2017 Sep 30;63(9):18-23. doi: 10.14715/cmb/2017.63.9.4.
• [3] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [4] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [5] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [8] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [9] Regulation of chromatin assembly and cell transformation by formaldehyde exposure in human cells. Environ Health Perspect. 2017 Sep 21;125(9):097019.