Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJJOI2B)

• DOT Name: Mitochondrial import receptor subunit TOM7 homolog (TOMM7)
• Synonyms: Translocase of outer membrane 7 kDa subunit homolog
• Gene Name: TOMM7
• UniProt ID: TOM7_HUMAN
• PDB ID: 7CK6; 7CP9; 7VBY; 7VC4; 7VD2; 7VDD
• Pfam ID: PF08038
• Sequence: MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG
• Function: Required for assembly and stability of the TOM complex. Positive regulator of PRKN translocation to damaged mitochondria. Acts probably by stabilizing PINK1 on the outer membrane of depolarized mitochondria.
• KEGG Pathway: Mitophagy - animal (hsa04137)
• Reactome Pathway:
  PINK1-PRKN Mediated Mitophagy (R-HSA-5205685)
  Mitochondrial protein import (R-HSA-1268020)

Molecular Interaction Atlas (MIA) of This DOT

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Mitochondrial import receptor subunit TOM7 homolog (TOMM7).	[1]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Mitochondrial import receptor subunit TOM7 homolog (TOMM7).	[2]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Mitochondrial import receptor subunit TOM7 homolog (TOMM7).	[3]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Mitochondrial import receptor subunit TOM7 homolog (TOMM7).	[4]
Vitamin C	DMXJ7O8	Approved	Vitamin C decreases the expression of Mitochondrial import receptor subunit TOM7 homolog (TOMM7).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Mitochondrial import receptor subunit TOM7 homolog (TOMM7).	[6]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Mitochondrial import receptor subunit TOM7 homolog (TOMM7).	[7]
AHPN	DM8G6O4	Investigative	AHPN decreases the expression of Mitochondrial import receptor subunit TOM7 homolog (TOMM7).	[8]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [3] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [4] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [5] Synergistic effects of arsenic trioxide combined with ascorbic acid in human osteosarcoma MG-63 cells: a systems biology analysis. Eur Rev Med Pharmacol Sci. 2014;18(24):3877-88.
• [6] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [7] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [8] ST1926, a novel and orally active retinoid-related molecule inducing apoptosis in myeloid leukemia cells: modulation of intracellular calcium homeostasis. Blood. 2004 Jan 1;103(1):194-207.