Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJRGHFG)

• DOT Name: Single-stranded DNA-binding protein 3 (SSBP3)
• Synonyms: Sequence-specific single-stranded-DNA-binding protein
• Gene Name: SSBP3
• UniProt ID: SSBP3_HUMAN
• Pfam ID: PF04503
• Sequence:
  MFAKGKGSAVPSDGQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLH
  SWWCVFWDLYCAAPERRDTCEHSSEAKAFHDYSAAAAPSPVLGNIPPNDGMPGGPIPPGF
  FQGPPGSQPSPHAQPPPHNPSSMMGPHSQPFMSPRYAGGPRPPIRMGNQPPGGVPGTQPL
  LPNSMDPTRQQGHPNMGGSMQRMNPPRGMGPMGPGPQNYGSGMRPPPNSLGPAMPGINMG
  PGAGRPWPNPNSANSIPYSSSSPGTYVGPPGGGGPPGTPIMPSPADSTNSSDNIYTMINP
  VPPGGSRSNFPMGPGSDGPMGGMGGMEPHHMNGSLGSGDIDGLPKNSPNNISGISNPPGT
  PRDDGELGGNFLHSFQNDNYSPSMTMSV
• Function: May be involved in transcription regulation of the alpha 2(I) collagen gene where it binds to the single-stranded polypyrimidine sequences in the promoter region.
• Tissue Specificity: Highly expressed in all hematopoietic tissues, including spleen, lymph node, peripheral blood, bone marrow, thymus, and fetal liver, with highest expression in thymus and fetal liver. Expression is also high in heart, brain, kidney, and skeletal muscle.

Molecular Interaction Atlas (MIA) of This DOT

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Single-stranded DNA-binding protein 3 (SSBP3).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Single-stranded DNA-binding protein 3 (SSBP3).	[2]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Single-stranded DNA-binding protein 3 (SSBP3).	[3]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Single-stranded DNA-binding protein 3 (SSBP3).	[4]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Single-stranded DNA-binding protein 3 (SSBP3).	[5]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Single-stranded DNA-binding protein 3 (SSBP3).	[9]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Single-stranded DNA-binding protein 3 (SSBP3).	[6]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Single-stranded DNA-binding protein 3 (SSBP3).	[7]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the methylation of Single-stranded DNA-binding protein 3 (SSBP3).	[8]

References

• [1] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [2] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [3] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [4] Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
• [5] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [6] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [7] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [8] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [9] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.