Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKBNCPF)

• DOT Name: Cell death-inducing p53-target protein 1 (CDIP1)
• Synonyms: Cell death involved p53-target; Cell death-inducing protein; LITAF-like protein; Lipopolysaccharide-induced tumor necrosis factor-alpha-like protein; Transmembrane protein I1
• Gene Name: CDIP1
• Related Disease: Asthma
• UniProt ID: CDIP1_HUMAN
• Pfam ID: PF10601
• Sequence:
  MSSEPPPPYPGGPTAPLLEEKSGAPPTPGRSSPAVMQPPPGMPLPPADIGPPPYEPPGHP
  MPQPGFIPPHMSADGTYMPPGFYPPPGPHPPMGYYPPGPYTPGPYPGPGGHTATVLVPSG
  AATTVTVLQGEIFEGAPVQTVCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLI
  PCLINDFKDVTHTCPSCKAYIYTYKRLC
• Function: Acts as an important p53/TP53-apoptotic effector. Regulates TNF-alpha-mediated apoptosis in a p53/TP53-dependent manner.
• Tissue Specificity: Highly expressed in brain. Expressed at lower level in heart, skeletal muscle, kidney, pancreas and liver. Weakly or not expressed in placenta and lung.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Asthma	DISW9QNS	Limited	Biomarker	[1]

8 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Cell death-inducing p53-target protein 1 (CDIP1).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Cell death-inducing p53-target protein 1 (CDIP1).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Cell death-inducing p53-target protein 1 (CDIP1).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Cell death-inducing p53-target protein 1 (CDIP1).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Cell death-inducing p53-target protein 1 (CDIP1).	[6]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Cell death-inducing p53-target protein 1 (CDIP1).	[7]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Cell death-inducing p53-target protein 1 (CDIP1).	[9]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Cell death-inducing p53-target protein 1 (CDIP1).	[10]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Cell death-inducing p53-target protein 1 (CDIP1).	[8]

References

• [1] A CCL chemokine-derived peptide (CDIP-2) exerts anti-inflammatory activity via CCR1, CCR2 and CCR3 chemokine receptors: Implications as a potential therapeutic treatment of asthma.Int Immunopharmacol. 2014 May;20(1):1-11. doi: 10.1016/j.intimp.2014.01.032. Epub 2014 Feb 20.
• [2] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [3] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [7] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [8] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [9] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [10] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.